Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

MPV17 Polyclonal antibody

MPV17 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Mitochondrial inner membrane protein Mpv17, Protein Mpv17

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for MPV17 in ?

Tested Applications

Positive WB detected inA549 cells, HeLa cells, HepG2 cells, mouse heart tissue, rat heart tissue
Positive IHC detected inhuman intrahepatic cholangiocarcinoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10310-1-AP targets MPV17 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0312

Product name: Recombinant human MPV17 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-175 aa of BC001115

Sequence: MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMVSLGCGFVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHR

Predict reactive species
Full Name MpV17 mitochondrial inner membrane protein
Calculated Molecular Weight 20 kDa
Observed Molecular Weight 20 kDa
GenBank Accession NumberBC001115
Gene Symbol MPV17
Gene ID (NCBI) 4358
RRIDAB_2144642
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP39210
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MPV17, also termed as SYM1, encodes an inner mitochondrial membrane protein. It's potential candidate that may account for the mitochondrial (mt) DNA depletion syndromes (MDDS) characterized by a severe, tissue-specific decrease of mtDNA copy number and ultimate organ failure. It's a human ortholog of the mouse kidney disease gene Mpv17. Absence or malfunction of MPV17 causes oxidative phosphorylation (OXPHOS) failure and mtDNA depletion, not only in affected individuals but also in Mpv17-/- mice. MPV17 contribute to ROS homeostasis, but the downstream signaling is unknown yet. Catalog# 10310-1-AP is a rabbit polyclonal antibody raised against the full-length of human MPV17.

Protocols

Product Specific Protocols
IF protocol for MPV17 antibody 10310-1-APDownload protocol
IHC protocol for MPV17 antibody 10310-1-APDownload protocol
WB protocol for MPV17 antibody 10310-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The MPV17 Polyclonal antibody (Cat# 10310-1-AP) has 11 citations published in journals including Nature Genetics, Nucleic Acids Research, Molecular Therapy, PLoS Genetics, PLoS ONE, Clinical Science, Molecular Genetics & Metabolism, American Journal of Physiology–Renal Physiology, American Journal of Translational Research, and BMC Research Notes. Research fields span mitochondrial DNA depletion syndromes, ribosome assembly, hepatic disease, β-cell apoptosis in diabetogenesis, podocyte protection, cancer cell proliferation, and myocardial ischemia/reperfusion injury.

SpeciesApplicationTitle
humanWB,IF

Nat Genet

MPV17 encodes an inner mitochondrial membrane protein and is mutated in infantile hepatic mitochondrial DNA depletion.

Authors - Spinazzola Antonella A
  • KO Validated
humanWB

Nucleic Acids Res

MPV17L2 is required for ribosome assembly in mitochondria.

Authors - Ilaria Dalla Rosa
mouseWB

Nucleic Acids Res

Aberrant ribonucleotide incorporation and multiple deletions in mitochondrial DNA of the murine MPV17 disease model.

Authors - Chloe F Moss
mouseWB

Mol Ther

AAV-mediated liver-specific MPV17 expression restores mtDNA levels and prevents diet-induced liver failure.

Authors - Emanuela Bottani
  • KO Validated
mouseWB,IF

Clin Sci (Lond)

Mitochondrial protein MPV17 promotes β-cell apoptosis in diabetogenesis

Authors - Qiaoli Tang
humanWB

Mol Genet Metab

Lethal hepatopathy and leukodystrophy caused by a novel mutation in MPV17 gene: description of an alternative MPV17 spliced form.

Authors - Navarro-Sastre Aleix A
Loading...
||
New chat

Able™

正在加载,请稍候...