Tested Applications
| Positive WB detected in | rabbit stomach tissue, human ileum tissue, rat rectum tissue, HeLa cells, rabbit large intestine, pig stomach, pig rectum, rat colon, mouse colon |
| Positive IHC detected in | human breast hyperplasia tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:20000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
60222-1-Ig targets SMMHC in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
| Tested Reactivity | human, mouse, rat, pig, rabbit |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13397 Product name: Recombinant human MYH11 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-351 aa of BC101677 Sequence: MAQKGQLSDDEKFLFVDKNFINSPVAQADWAAKRLVWVPSEKQGFEAASIKEEKGDEVVVELVENGKKVTVGKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGLFCVVVNPYKHLPIYSEKIVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKKDTSITGELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQARDERTFHIFYYMIAGAKEKMRSDLLLEGFNNYTFLSNGFVPIPAAQDDEMFQETVEAMAIMGFSEEEQLSILKVVS Predict reactive species |
| Full Name | myosin, heavy chain 11, smooth muscle |
| Calculated Molecular Weight | 1938 aa, 224 kDa |
| Observed Molecular Weight | 220 kDa |
| GenBank Accession Number | BC101677 |
| Gene Symbol | SMMHC/MYH11 |
| Gene ID (NCBI) | 4629 |
| RRID | AB_11182594 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P35749 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SMMHC (smooth muscle myosin heavy chain; MYH11) is a contractile protein of smooth muscle cells. It is specifically expressed in cells derived from smooth muscle lineages. SMMHC is used as vascular smooth muscle cell (vSMC) contractile marker. It is also an excellent marker for myoepithelial cells, with no or few cross-reaction with myofibroblasts, thus very useful in the evaluation of stromal invasion.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SMMHC antibody 60222-1-Ig | Download protocol |
| WB protocol for SMMHC antibody 60222-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-Myh11 (Cat# 60222-1-Ig) has 13 citations published in journals including Neuron, Advanced Science, Atherosclerosis, Biochemical Pharmacology, International Journal of Molecular Sciences, BBA Molecular Basis of Disease, Scientific Reports, Journal of Molecular and Cellular Cardiology, Stem Cells, Molecular and Cellular Biochemistry, Nutrition, Metabolism and Cardiovascular Diseases, Cardiovascular Toxicology, and Journal of Vascular Research. Research fields span cardiovascular/vascular biology, atherosclerosis, smooth muscle cell phenotyping, blood-brain barrier, fibrosis, and stem cell differentiation.
| Species | Application | Title |
|---|---|---|
Neuron Single-cell dissection of the human blood-brain barrier and glioma blood-tumor barrier | ||
Adv Sci (Weinh) BIN1 and ALDH1B1 Deficiency in Colonic Smooth Muscle Drives Mitochondrial Dysfunction and Fibrosis in Slow-Transit Constipation. | ||
Atherosclerosis Nrf2 deficiency attenuates atherosclerosis by reducing LOX-1-mediated proliferation and migration of vascular smooth muscle cells. | ||
Biochem Pharmacol TRPV4 maintains the contractile phenotype of VSMCs by regulating CPI-17 | ||
Int J Mol Sci Dietary Evodiamine Inhibits Atherosclerosis-Associated Changes in Vascular Smooth Muscle Cells | ||
Biochim Biophys Acta Mol Basis Dis Methamphetamine induces thoracic aortic aneurysm/dissection through C/EBPβ. |
Reviews
What customers say
The antibody received a 5-star rating from one reviewer who used it for Western Blot (lot 10003922). The reviewer reported that the antibody performed well in their Western blot experiments. Overall, the single review reflects a positive experience with this product.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Anja (Verified Customer) (04-17-2026) | The antibody performed well in the Western blot.
|
