• Featured Product
  • KD/KO Validated

NCOA5 Polyclonal antibody

NCOA5 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA
Cat No. 20175-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ChIP, ELISA

CIA, Coactivator independent of AF-2, KIAA1637, NCoA-5, Nuclear receptor coactivator 5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells
Positive IP detected inHEK-293 cells
Positive IHC detected inhuman stomach tissue, mouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells
Positive FC (Intra) detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20175-1-AP targets NCOA5 in WB, IHC, IF/ICC, FC (Intra), IP, ChIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, bovine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14014

Product name: Recombinant human NCOA5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 112-384 aa of BC056872

Sequence: DMRDSRDPMYRREGSYDRYLRMDDYCRRKDDSYFDRYRDSFDGRGPPGPESQSRAKERLKREERRREELYRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEETDKIINYLRERKERLMRSSTDSLPG

Predict reactive species
Full Name nuclear receptor coactivator 5
Calculated Molecular Weight 579 aa, 66 kDa
Observed Molecular Weight 66 kDa
GenBank Accession NumberBC056872
Gene Symbol NCOA5
Gene ID (NCBI) 57727
RRIDAB_10694674
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9HCD5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nuclear receptor coactivator 5 (NCOA5), also known as coactivator independent of AF-2 (CIA), possesses both repressor and activator functions (PMID: 11113208). It can interact with Estrogen Receptor (ER) alpha and ER beta in a ligand-dependent manner. NCOA5 has been shown to regulate the ER alpha-mediated transcription as well as the expression of the c-Myc gene (PMID: 11113208; 15073177). Recently identified as a conserved component of pluripotent stem cells, mammalian NCOA5 may contribute to the maintenance of the pluripotent stem cell population (PMID: 24268775).

Protocols

Product Specific Protocols
FC protocol for NCOA5 antibody 20175-1-APDownload protocol
IF protocol for NCOA5 antibody 20175-1-APDownload protocol
IHC protocol for NCOA5 antibody 20175-1-APDownload protocol
IP protocol for NCOA5 antibody 20175-1-APDownload protocol
WB protocol for NCOA5 antibody 20175-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Cell Rep

SILAC Proteomics of Planarians Identifies Ncoa5 as a Conserved Component of Pluripotent Stem Cells.

Authors - B?ser Alexander A
bovineWB,IF,ChIP

Biochem Biophys Res Commun

NCOA5 is a master regulator of amino acid-induced mTOR activation and β-casein synthesis in bovine mammary epithelial cells.

Authors - Xiaohan Yuan
  • KD Validated
humanWB,IHC

Cell Death Discov

NCOA5 induces sorafenib resistance in hepatocellular carcinoma by inhibiting ferroptosis

Authors - Shuang Gao
  • KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Matthew (Verified Customer) (10-01-2025)

Got great signal on both my western blot and immunofluorescence experiments when over-expressing NCOA5. I will definitely use in the future for other applications!

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:100 (IF); 1:1000 (WB)
  • Cell Tissue Type: 22rv1, PC3
FH

Moritz (Verified Customer) (09-26-2025)

worked well for HEK293T cells

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: HEK293T
NCOA5 Antibody Western Blot validation (1:2000 dilution) in HEK293T (Cat no:20175-1-AP)
FH

Aleksandr (Verified Customer) (12-16-2024)

Excellent antibody

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2500
  • Cell Tissue Type: RKO
NCOA5 Antibody Western Blot validation (1:2500 dilution) in RKO (Cat no:20175-1-AP)
FH

Tsimafei (Verified Customer) (08-07-2024)

Antibody recognize Ncoa5 band as well as (weakly) the upper non-specific band

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: U2OS
NCOA5 Antibody Western Blot validation (1:2000 dilution) in U2OS (Cat no:20175-1-AP)
FH

Julia (Verified Customer) (07-16-2024)

Alright. You can see some non-specific bands and ladder-binding but the correct band is more distinct.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: mESC
NCOA5 Antibody Western Blot validation (1:2000 dilution) in mESC (Cat no:20175-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...