Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human stomach tissue, mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
| Positive FC (Intra) detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20175-1-AP targets NCOA5 in WB, IHC, IF/ICC, FC (Intra), IP, ChIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14014 Product name: Recombinant human NCOA5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 112-384 aa of BC056872 Sequence: DMRDSRDPMYRREGSYDRYLRMDDYCRRKDDSYFDRYRDSFDGRGPPGPESQSRAKERLKREERRREELYRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEETDKIINYLRERKERLMRSSTDSLPG Predict reactive species |
| Full Name | nuclear receptor coactivator 5 |
| Calculated Molecular Weight | 579 aa, 66 kDa |
| Observed Molecular Weight | 66 kDa |
| GenBank Accession Number | BC056872 |
| Gene Symbol | NCOA5 |
| Gene ID (NCBI) | 57727 |
| RRID | AB_10694674 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9HCD5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Nuclear receptor coactivator 5 (NCOA5), also known as coactivator independent of AF-2 (CIA), possesses both repressor and activator functions (PMID: 11113208). It can interact with Estrogen Receptor (ER) alpha and ER beta in a ligand-dependent manner. NCOA5 has been shown to regulate the ER alpha-mediated transcription as well as the expression of the c-Myc gene (PMID: 11113208; 15073177). Recently identified as a conserved component of pluripotent stem cells, mammalian NCOA5 may contribute to the maintenance of the pluripotent stem cell population (PMID: 24268775).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for NCOA5 antibody 20175-1-AP | Download protocol |
| IF protocol for NCOA5 antibody 20175-1-AP | Download protocol |
| IHC protocol for NCOA5 antibody 20175-1-AP | Download protocol |
| IP protocol for NCOA5 antibody 20175-1-AP | Download protocol |
| WB protocol for NCOA5 antibody 20175-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-NCOA5 antibody (Cat# 20175-1-AP) has 4 total citations published in Science Advances, Cell Death Discovery, Cell Reports, and Biochemical and Biophysical Research Communications. Research fields span RNA splicing regulation via FUBP1 binding, sorafenib resistance and ferroptosis in hepatocellular carcinoma, pluripotent stem cell biology in planarians, and amino acid–induced mTOR activation in bovine mammary epithelial cells. Applications include WB, IHC, IF, and ChIP across human, mouse, and bovine species.
| Species | Application | Title |
|---|---|---|
Sci Adv Nuclear 2'-O-methylation regulates RNA splicing through its binding protein FUBP1. | ||
Cell Death Discov NCOA5 induces sorafenib resistance in hepatocellular carcinoma by inhibiting ferroptosis
| ||
Cell Rep SILAC Proteomics of Planarians Identifies Ncoa5 as a Conserved Component of Pluripotent Stem Cells. | ||
Biochem Biophys Res Commun NCOA5 is a master regulator of amino acid-induced mTOR activation and β-casein synthesis in bovine mammary epithelial cells.
|
Reviews
What customers say
All 5 reviewers rated this antibody 4–5 stars, primarily for Western Blot (one also used IF). Users report strong, specific signal at dilutions of 1:1000–1:2500 across multiple cell lines including HEK293T, U2OS, RKO, 22rv1, PC3, and mESC. The expected NCOA5 band is clearly detected. A couple of users noted minor non-specific bands or ladder binding, but the target band remained distinct. Overall, reviewers describe it as an excellent, reliable antibody and recommend it for future use.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Matthew (Verified Customer) (10-01-2025) | Got great signal on both my western blot and immunofluorescence experiments when over-expressing NCOA5. I will definitely use in the future for other applications!
|
Moritz (Verified Customer) (09-26-2025) | worked well for HEK293T cells
 |
Aleksandr (Verified Customer) (12-16-2024) | Excellent antibody
 |
Tsimafei (Verified Customer) (08-07-2024) | Antibody recognize Ncoa5 band as well as (weakly) the upper non-specific band
 |
Julia (Verified Customer) (07-16-2024) | Alright. You can see some non-specific bands and ladder-binding but the correct band is more distinct.
 |
