NME2 Polyclonal antibody

NME2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 20493-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

C-myc purine-binding transcription factor PUF, EC:2.7.13.3, EC:2.7.4.6, Histidine protein kinase NDKB, NDKB

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse kidney tissue, Jurkat cells, mouse liver tissue
Positive IHC detected inmouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 3 publications below

Product Information

20493-1-AP targets NME2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13913

Product name: Recombinant human NME2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-152 aa of BC002476

Sequence: MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE

Predict reactive species
Full Name non-metastatic cells 2, protein (NM23B) expressed in
Calculated Molecular Weight 152 aa, 17 kDa
Observed Molecular Weight 17 kDa
GenBank Accession NumberBC002476
Gene Symbol NME2
Gene ID (NCBI) 4831
RRIDAB_10695634
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP22392
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NME2(non-metastatic cells 2, protein) is also named as NDKB(Nucleoside diphosphate kinase B) and NM23B, and belongs to the NDK family. It is involved in the phosphorylation of nucleoside diphosphates, supplying nucleotide pools for DNA/RNA synthesis, and interacts with membrane receptors and constitutes a novel molecular regulatory mechanism of GPCR endocytosis. This protein has 2 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
IF protocol for NME2 antibody 20493-1-APDownload protocol
IHC protocol for NME2 antibody 20493-1-APDownload protocol
WB protocol for NME2 antibody 20493-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

J Hazard Mater

Integrative proteomics and metabolomics approach to elucidate metabolic dysfunction induced by silica nanoparticles in hepatocytes.

Authors - Ye Zhu
ratWB

Proteomics

FHL2-drived molecular network mediated Septin2 knockdown inducing apoptosis in mesangial cell.

Authors - Yang Lu
mouseWB

Biochem Biophys Res Commun

Nicotine induces Nme2-mediated apoptosis in mouse testes.

Authors - Yunqi Gu
Loading...
||
New chat Able
正在加载,请稍候...