Filter: AllWBIPIHCIF/ICC

WB analysis using 24050-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 24050-1-AP (Glucocorticoid receptor antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.
WB analysis using 24050-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 24050-1-AP (Glucocorticoid receptor antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.
WB analysis using 24050-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 24050-1-AP (Glucocorticoid receptor antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.
WB analysis using 24050-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 24050-1-AP (Glucocorticoid receptor antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.
WB analysis using 24050-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 24050-1-AP (Glucocorticoid receptor antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.
IP experiment of HepG2 using 24050-1-AP
IP result of anti-Glucocorticoid receptor (IP:24050-1-AP, 4ug; Detection:24050-1-AP 1:4000) with HepG2 cells lysate 1720 ug.
IP experiment of HepG2 using 24050-1-AP
IP result of anti-Glucocorticoid receptor (IP:24050-1-AP, 4ug; Detection:24050-1-AP 1:4000) with HepG2 cells lysate 1720 ug.
IP experiment of mouse heart using 24050-1-AP
IP result of anti-Glucocorticoid receptor (IP:24050-1-AP, 4ug; Detection:24050-1-AP 1:500) with mouse heart tissue lysate 4400ug.
IHC staining of human prostate cancer using 24050-1-AP
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 24050-1-AP (Glucocorticoid receptor antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human ovary tumor using 24050-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 24050-1-AP (Glucocorticoid receptor antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human ovary tumor using 24050-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 24050-1-AP (Glucocorticoid receptor antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human prostate cancer using 24050-1-AP
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 24050-1-AP (Glucocorticoid receptor antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IF Staining of HepG2 using 24050-1-AP
Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using Glucocorticoid receptor antibody (24050-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).
IF Staining of A549 using 24050-1-AP
Immunofluorescent analysis of (4% PFA) fixed A549 cells using Glucocorticoid receptor antibody (24050-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).
IF Staining of HepG2 using 24050-1-AP
Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using Glucocorticoid receptor antibody (24050-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

Featured Product
KD/KO Validated

Glucocorticoid receptor Polyclonal antibody

Name: Glucocorticoid receptor Polyclonal antibody
Brand: Proteintech
SKU: 24050-1-AP
Rating: 4.25 (4 reviews)

Glucocorticoid receptor Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 24050-1-AP

Publications(106)

Reviews (4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA

Synonyms

NR3C1, GRL, GR, GCR, GCCR

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

CoraLite® Plus 488 CoraLite®594

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (106)
Protocols
Reviews (4)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HEK-293 cells, HeLa cells, HepG2 cells, DU 145 cells, mouse brain tissue, rat brain tissue, PC-12 cells
Positive IP detected in	HepG2 cells, mouse heart tissue
Positive IHC detected in	human prostate cancer tissue, human ovary tumor tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HepG2 cells, A549 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:5000-1:50000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:50-1:500
Immunofluorescence (IF)/ICC	IF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

KD/KO	See 12 publications below
WB	See 75 publications below
IHC	See 10 publications below
IF	See 17 publications below
IP	See 3 publications below
CoIP	See 5 publications below
ChIP	See 21 publications below

Product Information

24050-1-AP targets Glucocorticoid receptor in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, rat, chicken, zebrafish, rare minnow
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag21146 Product name: Recombinant human Glucocorticoid receptor protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC015610 Sequence: MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGNVKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPI Predict reactive species
Full Name	nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)
Calculated Molecular Weight	86 kDa
Observed Molecular Weight	94-97 kDa
GenBank Accession Number	BC015610
Gene Symbol	Glucocorticoid receptor
Gene ID (NCBI)	2908
RRID	AB_2813890
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P04150
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glucocorticoid receptor (GR, or GCR) also known as NR3C1 (nuclear receptor subfamily 3, group C, member 1) is a receptor for glucocorticoids, which owns a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE) and as a modulator of other transcription factors. It is involved in cell proliferation and differentiation and specifically implicated in newborn birth weight, thus providing a biological mechanism by which NR3C1 expression may influence birth weight (PMID:22810058).

Protocols

Product Specific Protocols
IF protocol for Glucocorticoid receptor antibody 24050-1-AP	Download protocol
IHC protocol for Glucocorticoid receptor antibody 24050-1-AP	Download protocol
IP protocol for Glucocorticoid receptor antibody 24050-1-AP	Download protocol
WB protocol for Glucocorticoid receptor antibody 24050-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
human	WB	Cell Metab Individual-specific functional epigenomics reveals genetic determinants of adverse metabolic effects of glucocorticoids. Authors - Wenxiang Hu View Article
mouse	IHC	Cell Metab A macrophage-hepatocyte glucocorticoid receptor axis coordinates fasting ketogenesis. Authors - Anne Loft View Article
human	WB	Sci Adv Small-molecule inhibitor targeting orphan nuclear receptor COUP-TFII for prostate cancer treatment. Authors - Leiming Wang View Article
mouse	chIP	Mol Cell Cistromic Reprogramming of the Diurnal Glucocorticoid Hormone Response by High-Fat Diet. Authors - Fabiana Quagliarini View Article
mouse	WB,ChIP,IP	J Clin Invest REVERBa couples the circadian clock to hepatic glucocorticoid action. Authors - Giorgio Caratti View Article
mouse	ChIP	Mol Psychiatry The co-chaperone Fkbp5 shapes the acute stress response in the paraventricular nucleus of the hypothalamus of male mice. Authors - Alexander S Häusl View Article

Reviews

Add a review

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

FH Ping (Verified Customer) (06-04-2019)	This antibody works well for immunoprecipitation and western blot. Applications: Western Blot, Immunoprecipitation, Cell Tissue Type: mouse brain tissue
FH Yu Siong (Verified Customer) (04-23-2019)	Multiple bands observed - Total of 5 bands, not suitable for porcine brain endothelial cells, as non-specific binding tend to occur.Consistent in two Independent experiments Applications: Western Blot, Primary Antibody Dilution: 1:500 Cell Tissue Type: Porcine brain endothelial cells
FH Praveen (Verified Customer) (02-25-2019)	WORKS VERY WELL. Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Cell culture, ChIP, Cell Tissue Type: Ac16
FH Shubham (Verified Customer) (01-31-2019)	Antibody works great. Applications: Western Blot, Immunohistochemistry, Cell culture, Primary Antibody Dilution: 1:10 Cell Tissue Type: Ac16 Glucocorticoid receptor Antibody Western Blot,Immunohistochemistry,Cell culture, validation (1:10 dilution) in Ac16 (Cat no:24050-1-AP)