Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Occludin Polyclonal antibody

Occludin Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA

Cat No. 13409-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF/ICC, IF-P, IP, ELISA

OCLN

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, mouse liver tissue, human kidney tissue, human liver tissue, mouse colon tissue, mouse kidney tissue, rat kidney tissue, rat liver tissue
Positive IP detected inmouse liver tissue
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse colon tissue
Positive IF/ICC detected inMCF-7 cells, Caco-2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:800
Immunofluorescence (IF)-PIF-P : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13409-1-AP targets Occludin in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, canine, chicken, bovine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4057

Product name: Recombinant human Occludin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 270-522 aa of BC029886

Sequence: KMDRYDKSNILWDKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT

Predict reactive species
Full Name occludin
Calculated Molecular Weight 522 aa, 59 kDa
Observed Molecular Weight 59 kDa
GenBank Accession NumberBC029886
Gene Symbol Occludin
Gene ID (NCBI) 4950
RRIDAB_2156308
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ16625
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Occludin is an integral membrane protein located at the tight junction. It is a tetraspanin protein with four transmembrane domains, intracellular N and C termini and two extracellular loops. Occludin plays a role in the formation and regulation of the tight junction paracellular permeability barrier. Occludin can exist in different isoforms, owing to modifications at the posttranscriptional and posttranslational levels, the monomeric occludin migrates as 53-65 kDa on SDS-PAGE (PMID: 22083955; 19457074).

Protocols

Product Specific Protocols
IF protocol for Occludin antibody 13409-1-APDownload protocol
IHC protocol for Occludin antibody 13409-1-APDownload protocol
IP protocol for Occludin antibody 13409-1-APDownload protocol
WB protocol for Occludin antibody 13409-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Mol Cancer

Notch1 signaling regulates the epithelial¿mesenchymal transition and invasion of breast cancer in a Slug-dependent manner.

Authors - Shan Shao
mouseIHC

Nat Immunol

Parenteral BCG vaccine induces lung-resident memory macrophages and trained immunity via the gut–lung axis

Authors - Mangalakumari Jeyanathan
mouseWB,IF

Cell Host Microbe

A gut-secreted histidine methyltransferase enforces cross-kingdom catalytic antifungal defense.

Authors - Hong Bao
mouseIHC

Cell Host Microbe

Gut microbiome dysbiosis contributes to abdominal aortic aneurysm by promoting neutrophil extracellular trap formation

Authors - Zhenyu Tian

Nat Microbiol

Engineered Bacteroides thetaiotaomicron sense gut inflammation and deliver therapeutic molecules to alleviate colitis in mice.

Authors - Meng Ye
humanWB

Autophagy

Autophagy regulation and protein kinase activity of PIK3C3 controls sertoli cell polarity through its negative regulation on SCIN (scinderin)

Authors - Kehan Wang

Reviews

    4.6 out of 5
Add a review

6 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Kin (Verified Customer) (07-24-2025)

great antibody for both western blotting and IF staining.

  • Applications: Western Blot, Immunofluorescence
  • Cell Tissue Type: oesophageal barretts' cell lines

Tom (Verified Customer) (02-03-2023)

1:5000 on murine intestinal protein extract for 2h in TBST

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: Mouse intestines

Wu (Verified Customer) (12-09-2021)

The antibody gives a good detection of Occludin

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: gut
Occludin Antibody Immunofluorescence validation (1:100 dilution) in gut (Cat no:13409-1-AP)

Tom (Verified Customer) (09-21-2021)

Gave decent results with IHC at a concentration of 1:300-1:400 for mouse intestinal tissue

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:300-1:400
  • Cell Tissue Type: Mouse intestinal tissue

Amy (Verified Customer) (05-22-2019)

I approached Proteintech for guidance with regards to dilutions of this antibody, and with their help I optimized the protocol in good time. Very helpful!

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Mouse Colon

JIMMY (Verified Customer) (03-26-2019)

This antibody offers a good detection of Occludin on mouse brain endothelial cell line, bEnd3 cells, through IHC.

  • Applications: Immunofluorescence,
Loading...
||
New chat

Able

正在加载,请稍候...