PDE6A Polyclonal antibody

PDE6A Polyclonal Antibody for WB, IHC, IF, ELISA
Cat No. 21200-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

PDEA, PDE V-B1, PDE V B1, GMP-PDE alpha, EC:3.1.4.35

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse eye tissue, human brain tissue, rat eye tissue
Positive IHC detected inmouse eye tissue, human colon cancer tissue, human ovary cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF detected inretinal tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)IF : 1:50-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21200-1-AP targets PDE6A in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivitymouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15562

Product name: Recombinant human PDE6A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-90 aa of BC035909

Sequence: MGEVTAEEVEKFLDSNIGFAKQYYNLHYRAKLISDLLGAKEAAVDFSNYHSPSSMEESEIIFDLLRDFQENLQTEKCIFNVMKKLCFLLQ

Predict reactive species
Full Name phosphodiesterase 6A, cGMP-specific, rod, alpha
Calculated Molecular Weight 860 aa, 100 kDa
Observed Molecular Weight 100-110 kDa
GenBank Accession NumberBC035909
Gene Symbol PDE6A
Gene ID (NCBI) 5145
RRIDAB_10733345
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP16499
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PDE6A(Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha) is also named as GMP-PDE alpha, PDE V-B1, PDEA and belongs to the cyclic nucleotide phosphodiesterase family. PDE6A contains an open reading frame capable of coding for a polypeptide of 859 amino acids and about 100 kDa. It is a subunit of a key phototransduction enzyme which participates in processes of transmission and amplification of the visual signal. The expression of PDE6 alpha in retina is essential for normal expression of PDE6 beta and PDE6 gama.

Protocols

Product Specific Protocols
IHC protocol for PDE6A antibody 21200-1-APDownload protocol
WB protocol for PDE6A antibody 21200-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB, IF

Proc Natl Acad Sci U S A

Accumulation of non-outer segment proteins in the outer segment underlies photoreceptor degeneration in Bardet-Biedl syndrome.

Authors - Poppy Datta
mouseWB

J Biol Chem

The myosin-tail homology domain of centrosomal protein 290 is essential for protein confinement between the inner and outer segments in photoreceptors.

Authors - Poppy Datta
ratWB

Toxicol Appl Pharmacol

Ocular toxicity of AUY922 in pigmented and albino rats.

Authors - Danielle Roman
mouseWB

Dev Biol

Luteinizing hormone signaling phosphorylates and activates the cyclic GMP phosphodiesterase PDE5 in mouse ovarian follicles, contributing an additional component to the hormonally induced decrease in cyclic GMP that reinitiates meiosis.

Authors - Jeremy R Egbert
mouseWB

PLoS One

Mouse models of human ocular disease for translational research.

Authors - Mark P Krebs
IHC,WB

Exp Eye Res

Characterization of lncRNA and mRNA profiles in ciliary body in experimental myopia

Authors - Shanshan Wu
Loading...
||
New chat Able
正在加载,请稍候...