Tested Applications
| Positive WB detected in | mouse kidney tissue, mouse pancreas tissue, rat kidney tissue |
| Positive IP detected in | mouse kidney tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10147-1-AP targets t-Plasminogen activator/tPA in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0200 Product name: Recombinant human PLAT protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 359-516 aa of BC002795 Sequence: NDIALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP Predict reactive species |
| Full Name | plasminogen activator, tissue |
| Calculated Molecular Weight | 57 kDa |
| Observed Molecular Weight | 32-35 kDa, 65 kDa |
| GenBank Accession Number | BC002795 |
| Gene Symbol | tPA |
| Gene ID (NCBI) | 5327 |
| RRID | AB_2299701 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P00750 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Plasminogen activator, tissue (PLAT, synonyms: TPA, T-PA) is a tissue-type plasminogen activator, a secreted serine protease which converts the proenzyme plasminogen to plasmin, a fibrinolytic enzyme. Tissue-type plasminogen activator is synthesized as a single chain which is cleaved by plasmin to a two chain disulfide linked protein (33 kDa and 32 kDa). PLAT enzyme plays a role in cell migration and tissue remodeling. Increased enzymatic activity causes hyperfibrinolysis, which manifests as excessive bleeding; decreased activity leads to hypofibrinolysis which can result in thrombosis or embolism. tPA has 4 isoforms produced by alternative splicing with the MW of 63 kDa, 33 kDa, 57 kDa and 44 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for t-Plasminogen activator/tPA antibody 10147-1-AP | Download protocol |
| IHC protocol for t-Plasminogen activator/tPA antibody 10147-1-AP | Download protocol |
| IP protocol for t-Plasminogen activator/tPA antibody 10147-1-AP | Download protocol |
| WB protocol for t-Plasminogen activator/tPA antibody 10147-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The t-Plasminogen activator/tPA Polyclonal antibody (Cat# 10147-1-AP) has 39 citations across journals including Mol Cancer, Cell Metab, Cell Stem Cell, ACS Nano, Sci Adv, Biomaterials, Acta Neuropathol, J Neurosci, and Sci Rep. Research fields span oncology (renal, pancreatic, lung, and breast cancers), neuroscience (stroke, ischemia, depression), cardiovascular biology (thrombosis, angiogenesis, atherosclerosis), fibrinolysis, and biomaterials/tissue engineering (adhesion prevention, hydrogel design).
| Species | Application | Title |
|---|---|---|
Mol Cancer Single-cell multi-omics reveals that FABP1 + renal cell carcinoma drive tumor angiogenesis through the PLG-PLAT axis under fatty acid reprogramming
| ||
Cell Metab Astrocytic LRP1 enables mitochondria transfer to neurons and mitigates brain ischemic stroke by suppressing ARF1 lactylation | ||
Cell Stem Cell Fully biologic endothelialized-tissue-engineered vascular conduits provide antithrombotic function and graft patency | ||
ACS Nano Nonswellable Hydrogel Patch with Tissue-Mimetic Mechanical Characteristics Remodeling In Vivo Microenvironment for Effective Adhesion Prevention | ||
Redox Biol FUNDC1-dependent mitophagy induced by tPA protects neurons against cerebral ischemia-reperfusion injury.
| ||
Adv Sci (Weinh) Disruption of the Clock Component Bmal1 in Mice Promotes Cancer Metastasis through the PAI-1-TGF-β-myoCAF-Dependent Mechanism |
Reviews
What customers say
The single review for 10147-1-AP is from a Western Blot application on mouse brain lysate, rated 4 out of 5 stars. The reviewer used a 1:1000 dilution and observed the expected band at approximately 64 kD, but noted some nonspecific binding alongside the target signal. Overall, the antibody performed as expected in terms of molecular weight recognition, though specificity could be improved with optimization.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
nuo (Verified Customer) (08-22-2021) | There is a band at around 64 kD as expected, although there were other nonspecific bindings.
 |
