• Featured Product
  • KD/KO Validated

Biotin-conjugated t-Plasminogen activator/tPA Polyclonal antibody

t-Plasminogen activator/tPA Polyclonal Antibody for IHC
Cat No. Biotin-10147

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC

PLAT, tPA, T PA, Reteplase, EC:3.4.21.68

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Biotin
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inmouse brain tissue, human kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-10147 targets t-Plasminogen activator/tPA in IHC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0200

Product name: Recombinant human PLAT protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 359-516 aa of BC002795

Sequence: NDIALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP

Predict reactive species
Full Name plasminogen activator, tissue
Calculated Molecular Weight 57 kDa
Observed Molecular Weight 32-35 kDa, 65 kDa
GenBank Accession NumberBC002795
Gene Symbol tPA
Gene ID (NCBI) 5327
RRIDAB_2934328
Conjugate Biotin
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP00750
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Plasminogen activator, tissue (PLAT, synonyms: TPA, T-PA) is a tissue-type plasminogen activator, a secreted serine protease which converts the proenzyme plasminogen to plasmin, a fibrinolytic enzyme. Tissue-type plasminogen activator is synthesized as a single chain which is cleaved by plasmin to a two chain disulfide linked protein (33 kDa and 32 kDa). PLAT enzyme plays a role in cell migration and tissue remodeling. Increased enzymatic activity causes hyperfibrinolysis, which manifests as excessive bleeding; decreased activity leads to hypofibrinolysis which can result in thrombosis or embolism. tPA has 4 isoforms produced by alternative splicing with the MW of 63 kDa, 33 kDa, 57 kDa and 44 kDa.

Protocols

Product Specific Protocols
IHC protocol for Biotin t-Plasminogen activator/tPA antibody Biotin-10147Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...