Published Applications
| WB | See 3 publications below |
| IF | See 1 publications below |
Product Information
10579-1-AP targets RGS16 in WB, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0880 Product name: Recombinant human RGS16 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-202 aa of BC006243 Sequence: MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSEDVLGWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETRELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT Predict reactive species |
| Full Name | regulator of G-protein signaling 16 |
| Calculated Molecular Weight | 23 kDa |
| GenBank Accession Number | BC006243 |
| Gene Symbol | RGS16 |
| Gene ID (NCBI) | 6004 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15492 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RGS16 belongs to the 'regulator of G protein signaling' family. The RGS proteins are a family of highly diverse, multifunctional signaling proteins found in eukaryotic species ranging from yeast to mammals. It inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits. It also may play a role in regulating the kinetics of signaling in the phototransduction cascade.
Publications
| Species | Application | Title |
|---|---|---|
Genes Cancer RGS16, a novel p53 and pRb cross-talk candidate inhibits migration and invasion of pancreatic cancer cells. | ||
Bioengineered MEK1/2 inhibitor inhibits neointima formation by activating miR-126-3p/ C-X-C motif chemokine ligand 12 (CXCL12)/C-X-C motif chemokine receptor 4 (CXCR4) axis. | ||
Am J Physiol Renal Physiol Metabolic Acidosis Regulates RGS16 and G-protein Signaling in Osteoblasts. |
