Recombinant human SDS protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag9704
Synonyms
SDS, EC:4.3.1.17, EC:4.3.1.19, L serine deaminase, L threonine dehydratase
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MMSGEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSVGGGGLLCGVVQGLQEVGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITR
(1-218 aa encoded by BC020750) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
