Tested Applications
| Positive WB detected in | mouse brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue, human brain tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse cerebellum tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22592-1-AP targets SORLA in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18445 Product name: Recombinant human SORL1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1865-2214 aa of BC137171 Sequence: PRNVVYGIFYATSFLDLYRNPKSLTTSLHNKTVIVSKDEQYLFLVRVVVPYQGPSSDYVVVKMIPDSRLPPRHLHVVHTGKTSVVIKWESPYDSPDQDLLYAIAVKDLIRKTDRSYKVKSRNSTVEYTLNKLEPGGKYHIIVQLGNMSKDSSIKITTVSLSAPDALKIITENDHVLLFWKSLALKEKHFNESRGYEIHMFDSAMNITAYLGNTTDNFFKISNLKMGHNYTFTVQARCLFGNQICGEPAILLYDELGSGADASATQAARSTDVAAVVVPILFLILLSLGVGFAILYTKHRRLQSSFTAFANSHYSSRLGSAIFSSGDDLGEDDEDAPMITGFSDDVPMVIA Predict reactive species |
| Full Name | sortilin-related receptor, L(DLR class) A repeats-containing |
| Calculated Molecular Weight | 2214 aa, 248 kDa |
| Observed Molecular Weight | 300 kDa |
| GenBank Accession Number | BC137171 |
| Gene Symbol | SORLA |
| Gene ID (NCBI) | 6653 |
| RRID | AB_2879131 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | Q92673 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SorLA also known as SorL1 or LR11, is a multiligand receptor belonging to the LDL receptor superfamily. It is also a member of vacuolar protein sorting-10 (Vps10) family and is enriched in the brain. SorLA acts as an sorting receptor for APP and prevents amyloidogenic processing of APP. Downregulation of SorLA has been found in patients with sporadic Alzheimer disease (AD). Currently SorLA has emerged as a potential target for AD therapy. (25404298)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SORLA antibody 22592-1-AP | Download protocol |
| IHC protocol for SORLA antibody 22592-1-AP | Download protocol |
| IP protocol for SORLA antibody 22592-1-AP | Download protocol |
| WB protocol for SORLA antibody 22592-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SORLA Polyclonal antibody (Cat# 22592-1-AP) has 5 total citations. These appear in Advanced Science, PNAS, Environmental Research, Journal of Neurochemistry, and Functional & Integrative Genomics. The associated research fields include Alzheimer's disease and neurodegeneration, endo-lysosomal energy metabolism, environmental effects on brain cognition, and cisplatin resistance in ovarian cancer.
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Endo-Lysosomal Network Disorder Reprograms Energy Metabolism in SorL1-Null Rat Hippocampus | ||
Proc Natl Acad Sci U S A α2A adrenergic receptor promotes amyloidogenesis through disrupting APP-SorLA interaction. | ||
Funct Integr Genomics SORL1 stabilizes ABCB1 to promote cisplatin resistance in ovarian cancer
|
Reviews
What customers say
Based on the available reviews, this antibody received a positive rating (4/5) from a researcher who used it successfully for both immunoprecipitation and western blot on mouse brain tissue. The reviewer noted that it works well for these applications. Overall, the feedback is favorable, with the user confirming reliable performance in IP and WB experiments.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Ping (Verified Customer) (06-04-2019) | This antibody works well for immunoprecipitation and western blot.
|

















