Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

SORLA Polyclonal antibody

SORLA Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, CoIP, ELISA

SORL1, SorLA 1, SORL 1, Low-density lipoprotein receptor relative with 11 ligand-binding repeats, LDLR relative with 11 ligand-binding repeats

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for SORLA in ?

Tested Applications

Positive WB detected inmouse brain tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inmouse brain tissue, human brain tissue, rat brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse cerebellum tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22592-1-AP targets SORLA in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18445

Product name: Recombinant human SORL1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1865-2214 aa of BC137171

Sequence: PRNVVYGIFYATSFLDLYRNPKSLTTSLHNKTVIVSKDEQYLFLVRVVVPYQGPSSDYVVVKMIPDSRLPPRHLHVVHTGKTSVVIKWESPYDSPDQDLLYAIAVKDLIRKTDRSYKVKSRNSTVEYTLNKLEPGGKYHIIVQLGNMSKDSSIKITTVSLSAPDALKIITENDHVLLFWKSLALKEKHFNESRGYEIHMFDSAMNITAYLGNTTDNFFKISNLKMGHNYTFTVQARCLFGNQICGEPAILLYDELGSGADASATQAARSTDVAAVVVPILFLILLSLGVGFAILYTKHRRLQSSFTAFANSHYSSRLGSAIFSSGDDLGEDDEDAPMITGFSDDVPMVIA

Predict reactive species
Full Name sortilin-related receptor, L(DLR class) A repeats-containing
Calculated Molecular Weight 2214 aa, 248 kDa
Observed Molecular Weight 300 kDa
GenBank Accession NumberBC137171
Gene Symbol SORLA
Gene ID (NCBI) 6653
RRIDAB_2879131
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen Affinity purified
UNIPROT IDQ92673
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SorLA also known as SorL1 or LR11, is a multiligand receptor belonging to the LDL receptor superfamily. It is also a member of vacuolar protein sorting-10 (Vps10) family and is enriched in the brain. SorLA acts as an sorting receptor for APP and prevents amyloidogenic processing of APP. Downregulation of SorLA has been found in patients with sporadic Alzheimer disease (AD). Currently SorLA has emerged as a potential target for AD therapy. (25404298)

Protocols

Product Specific Protocols
IF protocol for SORLA antibody 22592-1-APDownload protocol
IHC protocol for SORLA antibody 22592-1-APDownload protocol
IP protocol for SORLA antibody 22592-1-APDownload protocol
WB protocol for SORLA antibody 22592-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The SORLA Polyclonal antibody (Cat# 22592-1-AP) has 5 total citations. These appear in Advanced Science, PNAS, Environmental Research, Journal of Neurochemistry, and Functional & Integrative Genomics. The associated research fields include Alzheimer's disease and neurodegeneration, endo-lysosomal energy metabolism, environmental effects on brain cognition, and cisplatin resistance in ovarian cancer.

SpeciesApplicationTitle
ratWB,IF

Adv Sci (Weinh)

Endo-Lysosomal Network Disorder Reprograms Energy Metabolism in SorL1-Null Rat Hippocampus

Authors - Yajie Wang
mouseWB, IP

Proc Natl Acad Sci U S A

α2A adrenergic receptor promotes amyloidogenesis through disrupting APP-SorLA interaction.

Authors - Yunjia Chen
mouseWB

Environ Res

Exposure to a real traffic environment impairs brain cognition in aged mice

Authors - Chenlu Xu
human,mouseWB,IF

J Neurochem

FOXP1 is a Transcription Factor for the Alzheimer's Disease Risk Gene SORL1

Authors - Xiaofeng Fu
humanWB,IHC,IF,CoIP

Funct Integr Genomics

SORL1 stabilizes ABCB1 to promote cisplatin resistance in ovarian cancer

Authors - Zhen Zheng
  • KD Validated

Reviews

    4.0 out of 5
Add a review

1 verified customer reviews

What customers say

Based on the available reviews, this antibody received a positive rating (4/5) from a researcher who used it successfully for both immunoprecipitation and western blot on mouse brain tissue. The reviewer noted that it works well for these applications. Overall, the feedback is favorable, with the user confirming reliable performance in IP and WB experiments.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Ping (Verified Customer) (06-04-2019)

This antibody works well for immunoprecipitation and western blot.

  • Applications: Western Blot, Immunoprecipitation,
  • Cell Tissue Type: mouse brain tissue
Loading...
||
New chat

Able™

正在加载,请稍候...