Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Sortilin Polyclonal antibody

Sortilin Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), IP, CoIP, ELISA

SORT1, 100 kDa NT receptor, Glycoprotein 95, Gp95, Neurotensin receptor 3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Sortilin in ?

Tested Applications

Positive WB detected inmouse brain tissue, human brain tissue, rat brain tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inmouse brain tissue, human brain tissue, rat brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inNeuro-2a cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12369-1-AP targets Sortilin in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2997

Product name: Recombinant human SORT1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 481-831 aa of BC023542

Sequence: EPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLLE

Predict reactive species
Full Name sortilin 1
Calculated Molecular Weight 831 aa, 92 kDa
Observed Molecular Weight 100-110 kDa
GenBank Accession NumberBC023542
Gene Symbol Sortilin
Gene ID (NCBI) 6272
ENSEMBL Gene IDENSG00000134243
RRIDAB_2302242
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ99523
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sortilin 1 (SORT1), is a trans-Golgi network (TGN) transmembrane protein and is a member of the Vps10p domain receptor family. SORT1 binds a number of unrelated ligands that participate in a wide range of cellular processes. It functions as a sorting receptor in the Golgi compartment and as a clearance receptor on the cell surface.

Protocols

Product Specific Protocols
FC protocol for Sortilin antibody 12369-1-APDownload protocol
IF protocol for Sortilin antibody 12369-1-APDownload protocol
IHC protocol for Sortilin antibody 12369-1-APDownload protocol
IP protocol for Sortilin antibody 12369-1-APDownload protocol
WB protocol for Sortilin antibody 12369-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-Sortilin (SORT1) affinity-purified antibody (Cat# 12369-1-AP) has 28 citations published in journals including Nature Communications, Cell Metabolism, PNAS, Theranostics, Advanced Science, Autophagy, FASEB Journal, and JCB. Research fields span lipid/energy metabolism, neurodegeneration (tau prions, α-synuclein), autophagy, vascular aging and atherosclerosis, immune regulation, cancer, bone healing, and developmental biology. Applications include WB, IF, IHC, IP, and CoIP across human, mouse, and rat species.

SpeciesApplicationTitle
mouseWB

Cell Metab

EHBP1 suppresses liver fibrosis in metabolic dysfunction-associated steatohepatitis

Authors - Fanglin Ma
humanIF

Autophagy

Impaired chaperone-mediated autophagy leads to abnormal SORT1 (sortilin 1) turnover and CES1-dependent triglyceride hydrolysis

Authors - You-Jin Choi
mouseWB,IP,IF

Nat Commun

Sortilin-mediated translocation of mitochondrial ACSL1 impairs adipocyte thermogenesis and energy expenditure in male mice

Authors - Min Yang
  • KO Validated
mouse,humanWB,IP,IF

Theranostics

RPS23RG1 inhibits SORT1-mediated lysosomal degradation of MDGA2 to protect against autism

Authors - Yuanhui Huo
humanWB,IF

Adv Sci (Weinh)

Dysfunctional Decidual CD4+T Cells Induce Recurrent Pregnancy Loss via Palmitoylation-Dependent Tim-3 Lysosomal Sorting and Degradation

Authors - Liyuan Cui
humanWB

EBioMedicine

Neurotensin contributes to pediatric intestinal failure-associated liver disease via regulating intestinal bile acids uptake.

Authors - Yongtao Xiao
  • KD Validated

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The single review for this product is from Renato Santos (2019), who rated it 5 stars. He used it for Western Blot on brain tissue at a 1:1000 dilution with 5% BSA as the diluent. He reported that the antibody produced a simple, clear band at the expected molecular weight, indicating reliable and specific performance in his application.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Renato (Verified Customer) (02-27-2019)

Produces a simple clear band and the expected molecular weight. Used as diluent 5% BSA.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Brain tissue
Loading...
||
New chat

Able™

正在加载,请稍候...