Tested Applications
| Positive WB detected in | mouse brain tissue, human brain tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue, human brain tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | Neuro-2a cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12369-1-AP targets Sortilin in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2997 Product name: Recombinant human SORT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 481-831 aa of BC023542 Sequence: EPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLLE Predict reactive species |
| Full Name | sortilin 1 |
| Calculated Molecular Weight | 831 aa, 92 kDa |
| Observed Molecular Weight | 100-110 kDa |
| GenBank Accession Number | BC023542 |
| Gene Symbol | Sortilin |
| Gene ID (NCBI) | 6272 |
| ENSEMBL Gene ID | ENSG00000134243 |
| RRID | AB_2302242 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99523 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Sortilin 1 (SORT1), is a trans-Golgi network (TGN) transmembrane protein and is a member of the Vps10p domain receptor family. SORT1 binds a number of unrelated ligands that participate in a wide range of cellular processes. It functions as a sorting receptor in the Golgi compartment and as a clearance receptor on the cell surface.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Sortilin antibody 12369-1-AP | Download protocol |
| IF protocol for Sortilin antibody 12369-1-AP | Download protocol |
| IHC protocol for Sortilin antibody 12369-1-AP | Download protocol |
| IP protocol for Sortilin antibody 12369-1-AP | Download protocol |
| WB protocol for Sortilin antibody 12369-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-Sortilin (SORT1) affinity-purified antibody (Cat# 12369-1-AP) has 28 citations published in journals including Nature Communications, Cell Metabolism, PNAS, Theranostics, Advanced Science, Autophagy, FASEB Journal, and JCB. Research fields span lipid/energy metabolism, neurodegeneration (tau prions, α-synuclein), autophagy, vascular aging and atherosclerosis, immune regulation, cancer, bone healing, and developmental biology. Applications include WB, IF, IHC, IP, and CoIP across human, mouse, and rat species.
| Species | Application | Title |
|---|---|---|
Cell Metab EHBP1 suppresses liver fibrosis in metabolic dysfunction-associated steatohepatitis | ||
Autophagy Impaired chaperone-mediated autophagy leads to abnormal SORT1 (sortilin 1) turnover and CES1-dependent triglyceride hydrolysis | ||
Nat Commun Sortilin-mediated translocation of mitochondrial ACSL1 impairs adipocyte thermogenesis and energy expenditure in male mice
| ||
Theranostics RPS23RG1 inhibits SORT1-mediated lysosomal degradation of MDGA2 to protect against autism | ||
Adv Sci (Weinh) Dysfunctional Decidual CD4+T Cells Induce Recurrent Pregnancy Loss via Palmitoylation-Dependent Tim-3 Lysosomal Sorting and Degradation | ||
EBioMedicine Neurotensin contributes to pediatric intestinal failure-associated liver disease via regulating intestinal bile acids uptake.
|
Reviews
What customers say
The single review for this product is from Renato Santos (2019), who rated it 5 stars. He used it for Western Blot on brain tissue at a 1:1000 dilution with 5% BSA as the diluent. He reported that the antibody produced a simple, clear band at the expected molecular weight, indicating reliable and specific performance in his application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Renato (Verified Customer) (02-27-2019) | Produces a simple clear band and the expected molecular weight. Used as diluent 5% BSA.
|
