• Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated Sortilin Polyclonal antibody

Sortilin Polyclonal Antibody for IF-P, FC (Intra)
Cat No. CL647-12369

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P, FC (Intra)

SORT1, 100 kDa NT receptor, Glycoprotein 95, Gp95, Neurotensin receptor 3

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue
Positive FC (Intra) detected inNeuro-2a cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-12369 targets Sortilin in IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2997

Product name: Recombinant human SORT1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 481-831 aa of BC023542

Sequence: EPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLLE

Predict reactive species
Full Name sortilin 1
Calculated Molecular Weight 831 aa, 92 kDa
Observed Molecular Weight 100-110 kDa
GenBank Accession NumberBC023542
Gene Symbol Sortilin
Gene ID (NCBI) 6272
ENSEMBL Gene IDENSG00000134243
RRIDAB_2920221
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ99523
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Sortilin 1 (SORT1), is a trans-Golgi network (TGN) transmembrane protein and is a member of the Vps10p domain receptor family. SORT1 binds a number of unrelated ligands that participate in a wide range of cellular processes. It functions as a sorting receptor in the Golgi compartment and as a clearance receptor on the cell surface.

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 Sortilin antibody CL647-12369Download protocol
IF protocol for CL Plus 647 Sortilin antibody CL647-12369Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...