Zyxin Monoclonal antibody

Zyxin Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 60254-1-Ig
Clone No.4D7E7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

4D7E7, ZYX, Zyxin-2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, A431 cells, MCF-7 cells
Positive IHC detected inhuman kidney tissue, human breast cancer tissue, human cervical cancer tissue, human placenta tissue, human testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60254-1-Ig targets Zyxin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0419

Product name: Recombinant human ZYX protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 278-572 aa of BC008743

Sequence: SKFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEELEQLTQQLMQDMEHPQRQNVAVNELCGRCHQPLARAQPAVRALGQLFHIACFTCHQCAQQLQGQQFYSLEGAPYCEGCYTDTLEKCNTCGEPITDRMLRATGKAYHPHCFTCVVCARPLEGTSFIVDQANRPHCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVALDKNFHMKCYKCEDCGKPLSIEADDNGCFPLDGHVLCRKCHTARAQT

Predict reactive species
Full Name zyxin
Calculated Molecular Weight 80 kDa
Observed Molecular Weight 78 kDa
GenBank Accession NumberBC008743
Gene Symbol Zyxin
Gene ID (NCBI) 7791
RRIDAB_2881375
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ15942
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Focal adhesions are actin-rich structures that enable cells to adhere to the extracellular matrix and at which protein complexes involved in signal transduction assemble. Zyxin (ZYX) is a zinc-binding phosphoprotein that concentrates at focal adhesions and along the actin cytoskeleton. Zyxin has an N-terminal proline-rich domain and three LIM domains in its C-terminal half. The proline-rich domain may interact with SH3 domains of proteins involved in signal transduction pathways while the LIM domains are likely involved in protein-protein binding. Zyxin may function as a messenger in the signal transduction pathway that mediates adhesion-stimulated changes in gene expression and may modulate the cytoskeletal organization of actin bundles.

Protocols

Product Specific Protocols
IF protocol for Zyxin antibody 60254-1-IgDownload protocol
IHC protocol for Zyxin antibody 60254-1-IgDownload protocol
WB protocol for Zyxin antibody 60254-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Ann Transl Med

Peptidome characterization of ovarian cancer serum and the identification of tumor suppressive peptide ZYX36-58.

Authors - Xusu Wang
humanWB

Aesthetic Plast Surg

In Vivo and In Vitro Fibroblasts' Behavior and Capsular Formation in Correlation with Smooth and Textured Silicone Surfaces.

Authors - Shu-Qing Huang
humanWB

J Mater Sci Mater Med

Surface changes of nanotopography by carbon ion implantation to enhance the biocompatibility of silicone rubber: an in vitro study of the optimum ion fluence and adsorbed protein.

Authors - Xianhui Li
humanIF

J Exp Clin Cancer Res

Tumor cell-derived SPON2 promotes M2-polarized tumor-associated macrophage infiltration and cancer progression by activating PYK2 in CRC.

Authors - Chengmei Huang
humanWB,IF

J Immunol Res

Tuftelin 1 Facilitates Hepatocellular Carcinoma Progression through Regulation of Lipogenesis and Focal Adhesion Maturation.

Authors - Lei Zhu
Loading...
||
New chat Able
正在加载,请稍候...