Tested Applications
| Positive WB detected in | mouse kidney tissue, HepG2 cells, human brain tissue, human testis tissue, mouse liver tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 19 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
21277-1-AP targets SR-BI in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15759 Product name: Recombinant human SCARB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-230 aa of BC022087 Sequence: MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILVLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIMWGYKDPLVNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGVQNISR Predict reactive species |
| Full Name | scavenger receptor class B, member 1 |
| Calculated Molecular Weight | 552 aa, 61 kDa |
| Observed Molecular Weight | 61-82 kDa |
| GenBank Accession Number | BC022087 |
| Gene Symbol | SR-BI |
| Gene ID (NCBI) | 949 |
| RRID | AB_10858921 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8WTV0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SR-BI antibody 21277-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Biomaterials Targeted immunomodulation of inflammatory monocytes across the blood-brain barrier by curcumin-loaded nanoparticles delays the progression of experimental autoimmune encephalomyelitis. | ||
J Virol Dengue virus NS1 leads to downregulation of HNF4 alpha in liver cells resulting in a decrease in coagulation factors I, V, X, and XIII, contributing to coagulopathy | ||
Atherosclerosis Flagellar hook protein FlgE promotes macrophage activation and atherosclerosis by targeting ATP5B | ||
J Virol Neglected but Important Role of Apolipoprotein E Exchange in Hepatitis C Virus Infection. | ||
J Cell Mol Med Photobiomodulation therapy promotes the ATP-binding cassette transporter A1-dependent cholesterol efflux in macrophage to ameliorate atherosclerosis. | ||
J Sci Food Agric L-Theanine regulates lipid metabolism by modulating gut microbiota and bile acid metabolism |









