Product Information
85742-2-PBS targets NRG4 as part of a matched antibody pair:
MP02113-1: 85742-1-PBS capture and 85742-2-PBS detection (validated in Cytometric bead array)
MP02113-2: 85742-3-PBS capture and 85742-2-PBS detection (validated in Cytometric bead array)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Eg0997 Product name: Recombinant Human NRG4 protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 2-62 aa of NM_138573.4 Sequence: PTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLF Predict reactive species |
Full Name | neuregulin 4 |
Calculated Molecular Weight | 13kDa |
GenBank Accession Number | NM_138573.4 |
Gene Symbol | NRG4 |
Gene ID (NCBI) | 145957 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q8WWG1 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |