Recombinant human A2ML1 protein
Source
e coli.-derived, PET28a
Tag
6*His
Format
Liquid
Cat no : Ag18656
Synonyms
A2ML1, alpha 2 macroglobulin like 1, Alpha-2-macroglobulin-like protein 1, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 9, CPAMD9
Validation Data Gallery View All
Product Information
| Peptide Sequence |
TLPNVPGMYTLEASGQGCVYVQTVLRYNILPPTNMKTFSLSVEIGKARCEQPTSPRSLTLTIHTSYVGSRSSSNMAIVEVKMLSGFSPMEGTNQLLLQQPLVKKVEFGTDTLNIYLDELIKNTQTYTFTISQSVLVTNLKPATIKVYDYYLPDEQATIQYSDPCE
(1290-1454 aa encoded by BC112131) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
