AADAT Polyclonal antibody, PBS Only

• 

  IHC staining of mouse cerebellum using 13031-1-AP (same clone as 13031-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 13031-1-AP (AADAT antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13031-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 13031-1-AP (same clone as 13031-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 13031-1-AP (AADAT antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 13031-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 13031-1-AP (same clone as 13031-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 13031-1-AP (AADAT antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 13031-1-PBS in a different storage buffer formulation.

AADAT Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 13031-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

2 aminoadipate transaminase, 2-aminoadipate aminotransferase, 2-aminoadipate transaminase, Alpha-aminoadipate aminotransferase, aminoadipate aminotransferase

---

Product Information

13031-1-PBS targets AADAT in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3676

  Product name: Recombinant human AADAT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 81-429 aa of BC031068

  Sequence: SAGIPELLSWLKQLQIKLHNPPTIHYQPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL

• Full Name: aminoadipate aminotransferase
• Calculated Molecular Weight: 429 aa, 48 kDa
• GenBank Accession Number: BC031068
• Gene Symbol: AADAT
• Gene ID (NCBI): 51166
• RRID: AB_2877904
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N5Z0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AADAT (alpha-aminoadipate aminotransferase), also known as KAT (kynurenine aminotransferase) II, is a primary enzyme in the brain for catalysing the transamination of kynurenine to KYNA (kynurenic acid). KYNA is the only known endogenous antagonist of the N-methyl-D-aspartate receptor. AADAT is also involved in lysine metabolism by catalyzing the transamination of aminoadipate to a-ketoadipate (PMID: 17024659, 18056995). The human AADAT enzyme is also predicted to contain a mitochondrial cleavage signal, suggesting that AADAT is a mitochondrial protein (PMID: 19826765).