AADAT Polyclonal antibody

• Home
• Products
• Primary Antibodies
• AADAT Polyclonal antibody (13031-1-AP)

AADAT Polyclonal Antibody for IHC, ELISA

Cat No. 13031-1-AP Copied!

Publications (7)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

2 aminoadipate transaminase, 2-aminoadipate aminotransferase, 2-aminoadipate transaminase, Alpha-aminoadipate aminotransferase, aminoadipate aminotransferase

• 

  IHC staining of mouse cerebellum using 13031-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 13031-1-AP (AADAT antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 13031-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 13031-1-AP (AADAT antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 13031-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 13031-1-AP (AADAT antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for AADAT in ?

Chat with Able

---

Tested Applications

• Positive IHC detected in: mouse cerebellum tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13031-1-AP targets AADAT in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3676

  Product name: Recombinant human AADAT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 81-429 aa of BC031068

  Sequence: SAGIPELLSWLKQLQIKLHNPPTIHYQPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL

• Full Name: aminoadipate aminotransferase
• Calculated Molecular Weight: 429 aa, 48 kDa
• GenBank Accession Number: BC031068
• Gene Symbol: AADAT
• Gene ID (NCBI): 51166
• RRID: AB_2877904
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N5Z0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AADAT (alpha-aminoadipate aminotransferase), also known as KAT (kynurenine aminotransferase) II, is a primary enzyme in the brain for catalysing the transamination of kynurenine to KYNA (kynurenic acid). KYNA is the only known endogenous antagonist of the N-methyl-D-aspartate receptor. AADAT is also involved in lysine metabolism by catalyzing the transamination of aminoadipate to a-ketoadipate (PMID: 17024659, 18056995). The human AADAT enzyme is also predicted to contain a mitochondrial cleavage signal, suggesting that AADAT is a mitochondrial protein (PMID: 19826765).

Publications

What published studies show

The AADAT Polyclonal antibody (Cat# 13031-1-AP) has 7 citations published in Cell Commun Signal, Neurochem Int, iScience, J Clin Med, Tissue Cell, Brain Struct Funct, and bioRxiv. Research fields span neurochemistry (neuronal and astrocytic localization of KAT2), tryptophan/kynurenine metabolism, circadian biology, aryl hydrocarbon receptor signaling, skeletal muscle metabolism in COPD, gastric intestinal metaplasia, and inflammatory effects of kynurenic acid on prefrontal cortical cognition.

Automatically generated from the 7 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC,IF	Cell Commun Signal; Helicobacter pylori promotes gastric intestinal metaplasia through activation of IRF3-mediated kynurenine pathway; Authors - Xinhua Liang
mouse	IHC	Neurochem Int; Species-specific neuronal localization of kynurenine aminotransferase-2 in the mouse cerebellum.; Authors - Emma Balog
mouse	WB	iScience; Circadian tryptophan metabolism contributes to systemic aryl hydrocarbon receptor activity.; Authors - Ethan W. Morgan
		J Clin Med; Impaired Skeletal Muscle Kynurenine Metabolism in Patients with Chronic Obstructive Pulmonary Disease.; Authors - Harry R Gosker
mouse	IF	Tissue Cell; Expression of kynurenine aminotransferase-2 in different mouse brain-derived cells: A comprehensive study in cell cultures.; Authors - Gyula Jenei
mouse	IF	Brain Struct Funct; Astrocytic and neuronal localization of kynurenine aminotransferase-2 in the adult mouse brain.; Authors - Judit Herédi