Tested Applications
Positive WB detected in | unboiled rat lung tissue |
Positive IHC detected in | mouse cerebellum tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
27450-1-AP targets ABCA3 in WB, IHC, ELISA applications and shows reactivity with human, rat samples.
Tested Reactivity | human, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24749 Product name: Recombinant human ABCA3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1606-1704 aa of BC140895 Sequence: GSGYSLRAKVQSEGQQEALEEFKAFVDLTFPGSVLEDEHQGMVHYHLPGRDLSWAKVFGILEKAKEKYGVDDYSVSQISLEQVFLSFAHLQPPTAEEGR Predict reactive species |
Full Name | ATP-binding cassette, sub-family A (ABC1), member 3 |
Observed Molecular Weight | 140-160 kDa |
GenBank Accession Number | BC140895 |
Gene Symbol | ABCA3 |
Gene ID (NCBI) | 21 |
RRID | AB_3669603 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q99758 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ABCA3 belongs to the ATP-binding cassette (ABC) transporter superfamily. ABCA3, which is expressed in alveolar type II pneumocytes and localizes predominantly to the limiting membrane of lamellar bodies, is critical for synthesis of surfactant(PMID: 17267394). Mutation of the ABCA3 gene causes fatal surfactant deficiency in newborns(PMID: 15044640).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ABCA3 antibody 27450-1-AP | Download protocol |
IHC protocol for ABCA3 antibody 27450-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |