Product Information
84057-2-PBS targets MRP3/ABCC3 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag19786 Product name: Recombinant human ABCC3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 838-960 aa of BC137348 Sequence: LLQRNGSFANFLCNYAPDEDQGHLEDSWTALEGAEDKEALLIEDTLSNHTDLTDNDPVTYVVQKQFMRQLSALSSDGEGQGRPVPRRHLGPSEKVQVTEAKADGALTQEEKAAIGTVELSVFW Predict reactive species |
| Full Name | ATP-binding cassette, sub-family C (CFTR/MRP), member 3 |
| Calculated Molecular Weight | 1527 aa, 169 kDa |
| GenBank Accession Number | BC137348 |
| Gene Symbol | MRP3 |
| Gene ID (NCBI) | 8714 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O15438 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
