Product Information
84057-2-PBS targets MRP3/ABCC3 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag19786 Product name: Recombinant human ABCC3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 838-960 aa of BC137348 Sequence: LLQRNGSFANFLCNYAPDEDQGHLEDSWTALEGAEDKEALLIEDTLSNHTDLTDNDPVTYVVQKQFMRQLSALSSDGEGQGRPVPRRHLGPSEKVQVTEAKADGALTQEEKAAIGTVELSVFW Predict reactive species |
Full Name | ATP-binding cassette, sub-family C (CFTR/MRP), member 3 |
Calculated Molecular Weight | 1527 aa, 169 kDa |
GenBank Accession Number | BC137348 |
Gene Symbol | MRP3 |
Gene ID (NCBI) | 8714 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | O15438 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |