ABCF2 Polyclonal antibody

• 

  WB analysis of NIH/3T3 using 10226-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 10226-1-AP (ABCF2 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 10226-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10226-1-AP (ABCF2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 10226-1-AP

  IP result of anti-ABCF2 (IP:10226-1-AP, 4ug; Detection:10226-1-AP 1:300) with HeLa cells lysate 3000 ug.

• 

  IHC staining of human colon cancer using 10226-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10226-1-AP (ABCF2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 10226-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using ABCF2 antibody (10226-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

ABCF2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10226-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

ABC28, ATP-binding cassette sub-family F member 2, HUSSY18, HUSSY-18, Iron-inhibited ABC transporter 2

---

Tested Applications

• Positive WB detected in: NIH/3T3 cells, HEK-293 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

10226-1-AP targets ABCF2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0310

  Product name: Recombinant human ABCF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-216 aa of BC001661

  Sequence: PSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMELYERLEELDADKAEMRASRILHGLG

• Full Name: ATP-binding cassette, sub-family F (GCN20), member 2
• Calculated Molecular Weight: 71 kDa
• Observed Molecular Weight: 71 kDa
• GenBank Accession Number: BC001661
• Gene Symbol: ABCF2
• Gene ID (NCBI): 10061
• RRID: AB_2304888
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UG63
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ABCF2 (ABC28, M-ABC1, HUSSY-18, EST133090, DKFZp586K1823) is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins are composed of transmembrane domains (TMDs), and nucleotide binding domains (NBDs, or ATP-binding cassettes, ABSs). Based on their sequence similarity scores, the members of the human ABC protein family can be grouped into eight subfamilies, including the MDR/TAP, the ALD, the MRP/CFTR, the ABC1, the White, the RNAseL inhibitor, the ANSA, and the GCN20 subfamilies. ABCF2 is a member of the GCN20 subfamily. ABC proteins transport various molecules across extra- and intracellular membranes.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Purification of cross-linked RNA-protein complexes by phenol-toluol extraction.; Authors - Erika C Urdaneta
	IHC	Elife; DMRT1 is a testis-determining gene in rabbits and is also essential for female fertility; Authors - Emilie Dujardin