ABCF2 Polyclonal antibody

ABCF2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 10226-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

ABC28, ATP-binding cassette sub-family F member 2, HUSSY18, HUSSY-18, Iron-inhibited ABC transporter 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNIH/3T3 cells, HEK-293 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10226-1-AP targets ABCF2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0310

Product name: Recombinant human ABCF2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 2-216 aa of BC001661

Sequence: PSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMELYERLEELDADKAEMRASRILHGLG

Predict reactive species
Full Name ATP-binding cassette, sub-family F (GCN20), member 2
Calculated Molecular Weight 71 kDa
Observed Molecular Weight 71 kDa
GenBank Accession NumberBC001661
Gene Symbol ABCF2
Gene ID (NCBI) 10061
RRIDAB_2304888
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UG63
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ABCF2 (ABC28, M-ABC1, HUSSY-18, EST133090, DKFZp586K1823) is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins are composed of transmembrane domains (TMDs), and nucleotide binding domains (NBDs, or ATP-binding cassettes, ABSs). Based on their sequence similarity scores, the members of the human ABC protein family can be grouped into eight subfamilies, including the MDR/TAP, the ALD, the MRP/CFTR, the ABC1, the White, the RNAseL inhibitor, the ANSA, and the GCN20 subfamilies. ABCF2 is a member of the GCN20 subfamily. ABC proteins transport various molecules across extra- and intracellular membranes.

Protocols

Product Specific Protocols
IF protocol for ABCF2 antibody 10226-1-APDownload protocol
IHC protocol for ABCF2 antibody 10226-1-APDownload protocol
IP protocol for ABCF2 antibody 10226-1-APDownload protocol
WB protocol for ABCF2 antibody 10226-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nat Commun

Purification of cross-linked RNA-protein complexes by phenol-toluol extraction.

Authors - Erika C Urdaneta
IHC

Elife

DMRT1 is a testis-determining gene in rabbits and is also essential for female fertility

Authors - Emilie Dujardin
Loading...
||
New chat Able
正在加载,请稍候...