Tested Applications
Positive WB detected in | Caco-2 cells, HepG2 cells, mouse colon tissue, mouse liver tissue, rat liver tissue |
Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 37 publications below |
IHC | See 1 publications below |
IF | See 1 publications below |
Product Information
27722-1-AP targets ABCG5 in WB, IHC, IF, ELISA applications and shows reactivity with Human, mouse, rat samples.
Tested Reactivity | Human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26844 Product name: Recombinant human ABCG5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-85 aa of NM_022436 Sequence: MGDLSSLTPGGSMGLQVNRGSQSSLEGAPATAPEPHSLGILHASYSVSHRVRPWWDITSCRQQWTRQILKDVSLYVESGQIMCIL Predict reactive species |
Full Name | ATP-binding cassette, sub-family G (WHITE), member 5 |
Calculated Molecular Weight | 72 kDa |
Observed Molecular Weight | 68 kDa~72 kDa |
GenBank Accession Number | NM_022436 |
Gene Symbol | ABCG5 |
Gene ID (NCBI) | 64240 |
RRID | AB_2880952 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9H222 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ABCG5 antibody 27722-1-AP | Download protocol |
IHC protocol for ABCG5 antibody 27722-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Diabetes Long Noncoding RNA lncRHL Regulates Hepatic VLDL Secretion by Modulating hnRNPU/ BMAL1/MTTP Axis. | ||
Cell Mol Gastroenterol Hepatol A Mitochondrial DNA Variant Elevates the Risk of Gallstone Disease by Altering Mitochondrial Function. | ||
Mol Ther Nucleic Acids HFD-induced TRAF6 upregulation promotes liver cholesterol accumulation and fatty liver development via EZH2-mediated miR-429/PPARα axis. | ||
J Cell Mol Med The marine-derived furanone reduces intracellular lipid accumulation in vitro by targeting LXRα and PPARα. | ||
Front Nutr Preparation of microgel co-loaded with nuciferine and epigallocatechin-3-gallate for the regulation of lipid metabolism | ||
Biochem Pharmacol Resveratrol enhances trans-intestinal cholesterol excretion through selective activation of intestinal liver X receptor alpha. |