Use Able AI chat for product recommendations

ACAA1 Polyclonal antibody

ACAA1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 12319-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

3 ketoacyl CoA thiolase, peroxisomal, 3-ketoacyl-CoA thiolase, peroxisomal, ACAA, Acetyl CoA acyltransferase, Acetyl-CoA acyltransferase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inL02 cells, A549 cells, human lung tissue
Positive IHC detected inhuman thyroid cancer tissue, human lung tissue, human prostate cancer tissue, human liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inU-251 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12319-2-AP targets ACAA1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2972

Product name: Recombinant human ACAA1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 117-424 aa of BC011977

Sequence: STVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN

Predict reactive species
Full Name acetyl-Coenzyme A acyltransferase 1
Calculated Molecular Weight 424 aa, 44 kDa
Observed Molecular Weight 41 kDa
GenBank Accession NumberBC011977
Gene Symbol ACAA1
Gene ID (NCBI) 30
RRIDAB_2289045
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP09110
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACAA1 (acetyl-CoA acyltransferase 1) is an enzyme involved in lipid β-oxidation and provides substrates to the tricarboxylic acid (TCA) cycle, a critical step in cellular metabolism (PMID:33194642). ACAA1 is also a biomarker in type 2 diabetes (T2D), predicting the pre-diabetic metabolic signature in mouse models (PMID:25784953). Moreover, ACAA1 is highly expressed in TNBC, serving as a potential therapeutic target in ACAA1-high tumors and a predictive biomarker of resistance to CDK4/6 inhibitors for RB1-proficient patients (PMID:37129951).

Protocols

Product Specific Protocols
IF protocol for ACAA1 antibody 12319-2-APDownload protocol
IHC protocol for ACAA1 antibody 12319-2-APDownload protocol
WB protocol for ACAA1 antibody 12319-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanIF

Drug Resist Updat

MYC expression and fatty acid oxidation in EGFR-TKI acquired resistance

Authors - GuoSheng Wang
humanIF

Hum Mol Genet

Functional analysis of PEX13 mutation in a Zellweger syndrome spectrum patient reveals novel homooligomerization of PEX13 and its role in human peroxisome biogenesis.

Authors - Krause Cindy C
humanWB

Cell Mol Life Sci

Murine deficiency of peroxisomal L-bifunctional protein (EHHADH) causes medium-chain 3-hydroxydicarboxylic aciduria and perturbs hepatic cholesterol homeostasis.

Authors - Pablo Ranea-Robles
ratWB

EBioMedicine

PPARγ maintains the metabolic heterogeneity and homeostasis of renal tubules.

Authors - Zhongshi Lyu
mouseWB

Commun Biol

Transmembrane protein 135 regulates lipid homeostasis through its role in peroxisomal DHA metabolism

Authors - Michael Landowski
IF

J Agric Food Chem

Proteomic Analysis of Lysosomal Membrane Proteins in Bovine Mammary Epithelial Cells Illuminates Potential Novel Lysosome Functions in Lactation.

Authors - Chaochao Luo

Reviews

    4.6 out of 5
Add a review

3 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Yueming (Verified Customer) (10-02-2025)

Very good IF staining results

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: B16 melanoma
ACAA1 Antibody Immunofluorescence validation (1:100 dilution) in B16 melanoma (Cat no:12319-2-AP)

PAULA (Verified Customer) (07-12-2023)

I tested this ACAA1 antibody on THP1 cells (20 ug total cell lysate) and two nice bands were observed at the most concentrated dilution (1:250), although they were located slightly below the predicted molecular weight.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500, 1:250
  • Cell Tissue Type: THP1 cell line
ACAA1 Antibody Western Blot validation (1:500, 1:250 dilution) in THP1 cell line (Cat no:12319-2-AP)

Tom (Verified Customer) (04-01-2022)

1:1000 for 18 hours at 4 degrees

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Cos7
ACAA1 Antibody Western Blot validation (1:1000 dilution) in Cos7 (Cat no:12319-2-AP)
Loading...
||
New chat

Able

正在加载,请稍候...