CoraLite® Plus 488-conjugated ACAA1 Polyclonal antibody

ACAA1 Polyclonal Antibody for IF/ICC
Cat No. CL488-12319

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

3 ketoacyl CoA thiolase, peroxisomal, 3-ketoacyl-CoA thiolase, peroxisomal, ACAA, Acetyl CoA acyltransferase, Acetyl-CoA acyltransferase

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inU-251 cells
Positive FC (Intra) detected inU-251 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-12319 targets ACAA1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2972

Product name: Recombinant human ACAA1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 117-424 aa of BC011977

Sequence: STVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN

Predict reactive species
Full Name acetyl-Coenzyme A acyltransferase 1
Calculated Molecular Weight 424 aa, 44 kDa
Observed Molecular Weight 41 kDa
GenBank Accession NumberBC011977
Gene Symbol ACAA1
Gene ID (NCBI) 30
RRIDAB_3672536
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP09110
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

ACAA1 (acetyl-CoA acyltransferase 1) is an enzyme involved in lipid β-oxidation and provides substrates to the tricarboxylic acid (TCA) cycle, a critical step in cellular metabolism (PMID:33194642). ACAA1 is also a biomarker in type 2 diabetes (T2D), predicting the pre-diabetic metabolic signature in mouse models (PMID:25784953). Moreover, ACAA1 is highly expressed in TNBC, serving as a potential therapeutic target in ACAA1-high tumors and a predictive biomarker of resistance to CDK4/6 inhibitors for RB1-proficient patients (PMID:37129951).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 ACAA1 antibody CL488-12319Download protocol
IF protocol for CL Plus 488 ACAA1 antibody CL488-12319Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...