Filter: AllWBIHCIF-P

WB analysis using 67742-1-Ig (same clone as 67742-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67742-1-Ig (ACADM antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67742-1-PBS in a different storage buffer formulation.
×
Various lysates were subjected to SDS PAGE followed by western blot with 67742-1-Ig (ACADM antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67742-1-PBS in a different storage buffer formulation.
WB analysis of rat liver using 67742-1-Ig (same clone as 67742-1-PBS)
rat liver tissue were subjected to SDS PAGE followed by western blot with 67742-1-Ig (ACADM antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67742-1-PBS in a different storage buffer formulation.
WB analysis of HSC-T6 using 67742-1-Ig (same clone as 67742-1-PBS)
HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67742-1-Ig (ACADM antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67742-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 67742-1-Ig (same clone as 67742-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67742-1-Ig (ACADM antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67742-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 67742-1-Ig (same clone as 67742-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67742-1-Ig (ACADM antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67742-1-PBS in a different storage buffer formulation.
IHC staining of human heart using 67742-1-Ig (same clone as 67742-1-PBS)
Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 67742-1-Ig (ACADM antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67742-1-PBS in a different storage buffer formulation.
IHC staining of human heart using 67742-1-Ig (same clone as 67742-1-PBS)
Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 67742-1-Ig (ACADM antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67742-1-PBS in a different storage buffer formulation.
IF Staining of human liver cancer using 67742-1-Ig (same clone as 67742-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using ACADM antibody (67742-1-Ig, Clone: 1A11G6 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67742-1-PBS in a different storage buffer formulation.

ACADM Monoclonal antibody, PBS Only

ACADM Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 67742-1-PBS

Clone No.1A11G6

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human, rat, pig

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

1A11G6, ACAD, ACAD 1, ACAD1, EC:1.3.8.7

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

67742-1-PBS targets ACADM in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, rat, pig samples.

Tested Reactivity	human, rat, pig
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag30620 Product name: Recombinant human ACADM protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 205-352 aa of BC005377 Sequence: ARSDPDPKAPANKAFTGFIVEADTPGIQIGRKELNMGQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDKTRPVVAAGAVGLAQRALDEATKYALERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSGRRNTY Predict reactive species
Full Name	acyl-Coenzyme A dehydrogenase, C-4 to C-12 straight chain
Calculated Molecular Weight	421 aa, 47 kDa
Observed Molecular Weight	42 kDa
GenBank Accession Number	BC005377
Gene Symbol	ACADM
Gene ID (NCBI)	34
RRID	AB_2918511
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P11310
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

ACADM, also named as MCAD, belongs to the acyl-CoA dehydrogenase family. This enzyme is specific for acyl chain lengths of 4 to 16. It catalyzes the reaction: Acyl-CoA + acceptor = 2,3-dehydroacyl-CoA + reduced acceptor. Defects in ACADM are the cause of medium-chain acyl-CoA dehydrogenase deficiency (MCAD deficiency). This protein can exsit as a dimer(PMID:8962055). This antibody is specific to ACADM.