ACADM Monoclonal antibody, PBS Only

ACADM Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA
Cat No. 67742-1-PBS
Clone No.1A11G6

Host / Isotype

Mouse / IgG1

Reactivity

human, rat, pig

Applications

WB, IHC, IF-P, Indirect ELISA

1A11G6, ACAD, ACAD 1, ACAD1, EC:1.3.8.7

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67742-1-PBS targets ACADM in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, rat, pig samples.

Tested Reactivity human, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30620

Product name: Recombinant human ACADM protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 205-352 aa of BC005377

Sequence: ARSDPDPKAPANKAFTGFIVEADTPGIQIGRKELNMGQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDKTRPVVAAGAVGLAQRALDEATKYALERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSGRRNTY

Predict reactive species
Full Name acyl-Coenzyme A dehydrogenase, C-4 to C-12 straight chain
Calculated Molecular Weight 421 aa, 47 kDa
Observed Molecular Weight42 kDa
GenBank Accession NumberBC005377
Gene Symbol ACADM
Gene ID (NCBI) 34
RRIDAB_2918511
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP11310
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ACADM, also named as MCAD, belongs to the acyl-CoA dehydrogenase family. This enzyme is specific for acyl chain lengths of 4 to 16. It catalyzes the reaction: Acyl-CoA + acceptor = 2,3-dehydroacyl-CoA + reduced acceptor. Defects in ACADM are the cause of medium-chain acyl-CoA dehydrogenase deficiency (MCAD deficiency). This protein can exsit as a dimer(PMID:8962055). This antibody is specific to ACADM.

Loading...
||
New chat Able
正在加载,请稍候...