Tested Applications
| Positive WB detected in | PC-3 cells, HEK-293 cells, HSC-T6 cells, rat liver tissue, HeLa cells, HepG2 cells |
| Positive IHC detected in | human liver tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human liver cancer tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67742-1-Ig targets ACADM in WB, IHC, IF-P, ELISA applications and shows reactivity with human, rat, pig samples.
| Tested Reactivity | human, rat, pig |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30620 Product name: Recombinant human ACADM protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 205-352 aa of BC005377 Sequence: ARSDPDPKAPANKAFTGFIVEADTPGIQIGRKELNMGQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDKTRPVVAAGAVGLAQRALDEATKYALERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSGRRNTY Predict reactive species |
| Full Name | acyl-Coenzyme A dehydrogenase, C-4 to C-12 straight chain |
| Calculated Molecular Weight | 421 aa, 47 kDa |
| Observed Molecular Weight | 42 kDa |
| GenBank Accession Number | BC005377 |
| Gene Symbol | ACADM |
| Gene ID (NCBI) | 34 |
| RRID | AB_2918511 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P11310 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ACADM, also named as MCAD, belongs to the acyl-CoA dehydrogenase family. This enzyme is specific for acyl chain lengths of 4 to 16. It catalyzes the reaction: Acyl-CoA + acceptor = 2,3-dehydroacyl-CoA + reduced acceptor. Defects in ACADM are the cause of medium-chain acyl-CoA dehydrogenase deficiency (MCAD deficiency). This protein can exsit as a dimer(PMID:8962055). This antibody is specific to ACADM.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ACADM antibody 67742-1-Ig | Download protocol |
| IHC protocol for ACADM antibody 67742-1-Ig | Download protocol |
| WB protocol for ACADM antibody 67742-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ACADM Monoclonal antibody (catalog number 67742-1-Ig) has 6 total citations. These appear in journals including Advanced Science, Phytomedicine, International Journal of Molecular Sciences, Journal of Steroid Biochemistry and Molecular Biology, and PLoS One. The associated research fields span liver metastasis in colorectal cancer, acetaminophen-induced liver injury, fenofibrate effects on heart and kidney metabolism, vitamin D and β-oxidation in pigs, and mitochondria-related biomarkers in ulcerative colitis. Applications were primarily Western blot, with some IF and IHC.
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) N-glycosylation Modification of CTSD Affects Liver Metastases in Colorectal Cancer | ||
Phytomedicine Shenqi Pill alleviates acetaminophen-induced liver injury: a comprehensive strategy of network pharmacology and spectrum-effect relationship reveals mechanisms and active components | ||
Int J Mol Sci Fenofibrate Differently Affects the Heart's Morphology and Metabolism in Young and Old Rats | ||
Int J Mol Sci High-Dose Fenofibrate Stimulates Multiple Cellular Stress Pathways in the Kidney of Old Rats | ||
J Steroid Biochem Mol Biol Very high-dose vitamin D₃ supplementation reduces the expression of genes and proteins engaged in β-oxidation in healthy pigs | ||
PLoS One Unveiling and verification of mitochondria-related genes as potential diagnostic biomarkers in ulcerative colitis based on bioinformatics analysis and experimental validation. |
Reviews
What customers say
The single review for this antibody is a 5-star rating for Western Blot. The user reported that the antibody produced a single, clear band at the expected molecular weight with a strong signal in rat kidney tissue homogenates at a 1:5000 dilution. They described the antibody as "excellent on every try," indicating consistent and reliable performance across multiple experiments.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Agata (Verified Customer) (04-16-2024) | The antibody used in WB gave a single clear band, of appropriate weight, with a strong signal, in rat kidney tissue homogenates - the antibody was excellent on every try.
 |
