ACSM2A Polyclonal antibody

• 

  WB analysis using 22862-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22862-1-AP (ACSM2A antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 22862-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 22862-1-AP (ACSM2A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 22862-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 22862-1-AP (ACSM2A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 22862-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 22862-1-AP (ACSM2A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 22862-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using 22862-1-AP (ACSM2A antibody), at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

ACSM2A Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 22862-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

A 923A4.1, ACSM2, ACSM2A, Butyrate CoA ligase 2A, MACS2

---

Tested Applications

• Positive WB detected in: mouse liver tissue, human brain tissue, rat liver tissue, mouse kidney tissue
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below

Product Information

22862-1-AP targets ACSM2A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18856

  Product name: Recombinant human ACSM2A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 223-390 aa of BC125176

  Sequence: GTSGLPKMAEHSYSSLGLKAKMDAGWTGLQASDIMWTISDTGWILNILCSLMEPWALGACTFVHLLPKFDPLVILKTLSSYPIKSMMGAPIVYRMLLQQDLSSYKFPHLQNCVTVGESLLPETLENWRAQTGLDIRESYGQTETGLTCMVSKTMKIKPGYMGTAASCY

• Full Name: acyl-CoA synthetase medium-chain family member 2A
• Calculated Molecular Weight: 577 aa, 64 kDa
• Observed Molecular Weight: 60-64 kDa
• GenBank Accession Number: BC125176
• Gene Symbol: ACSM2A
• Gene ID (NCBI): 123876
• RRID: AB_2879181
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q08AH3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACSM2A(Acyl-coenzyme A synthetase ACSM2A, mitochondrial) is also named as ACSM2, MACS2 and belongs to the ATP-dependent AMP-binding enzyme family. It acts as a medium-chain fatty acid : CoA ligase with the caculated molecular weight of 64 kDa and acts on acids from C(4) to C(11) and on the corresponding 3-hydroxy- and 2,3- or 3,4-unsaturated acids.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Front Physiol; Proteomics analyses of acute kidney injury biomarkers in a rat exertional heat stroke model; Authors - Fu-Li Wen
mouse	WB	Front Mol Med; Loss of PPARα function promotes epigenetic dysregulation of lipid homeostasis driving ferroptosis and pyroptosis lipotoxicity in metabolic dysfunction associated Steatotic liver disease (MASLD); Authors - Claudia Theys
human	WB	Mol Cancer; Therapy-induced senescence is a transient drug resistance mechanism in breast cancer; Authors - Eszter Bajtai