AHR Monoclonal antibody

• 

  WB analysis using 67785-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67785-1-Ig (AHR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 67785-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67785-1-Ig (AHR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 67785-1-Ig

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 67785-1-Ig (AHR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 67785-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67785-1-Ig (AHR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HSC-T6 using 67785-1-Ig

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67785-1-Ig (AHR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of 4T1 using 67785-1-Ig

  4T1 cells were subjected to SDS PAGE followed by western blot with 67785-1-Ig (AHR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 67785-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67785-1-Ig (AHR antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 67785-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67785-1-Ig (AHR antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human breast cancer using 67785-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human breast cancer tissue using AHR antibody (67785-1-Ig, Clone: 2D1F9 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). Blue (DAPI).

• 

  IF Staining of mouse testis using 67785-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using AHR antibody (67785-1-Ig, Clone: 2D1F9 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of HepG2 using 67785-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using AHR antibody (67785-1-Ig, Clone: 2D1F9 ) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

AHR Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 67785-1-Ig

Clone No.2D1F9

Publications(60)

Reviews (2)

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Synonyms

Class E basic helix-loop-helix protein 76, bHLHe76, Ah receptor, 2D1F9

---

Tested Applications

• Positive WB detected in: A549 cells, LNCaP cells, MCF-7 cells, HEK-293 cells, HSC-T6 cells, 4T1 cells, PC-3 cells, HeLa cells, Caco-2 cells, HepG2 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human breast cancer tissue, mouse testis tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:200-1:500
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 52 publications below
• IHC: See 6 publications below
• IF: See 11 publications below
• FC: See 1 publications below

Product Information

67785-1-Ig targets AHR in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, zebrafish
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28935

  Product name: Recombinant human AHR protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 25-300 aa of BC070080

  Sequence: PIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPSQCTESGQGIEEATGLPQTVVCYNPDQIPPENSPLMERCFICRLRCLLDNSSGFLAMNFQGKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGC

• Full Name: aryl hydrocarbon receptor
• Calculated Molecular Weight: 848 aa, 96 kDa
• Observed Molecular Weight: 105-110 kDa
• GenBank Accession Number: BC070080
• Gene Symbol: AHR
• Gene ID (NCBI): 196
• RRID: AB_2918549
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P35869
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The aryl hydrocarbon receptor (AhR) is a ligand-activated transcription factor that has been largely regarded as a mediator of xenobiotic metabolism [PMID:18483242]. It plays a part role in physiologic activities, including attenuation of the acute phase response, cytokine signaling, T helper (TH)17 immune cell differentiation, modulation of NF-κB activity, and regulation of hormonal signaling [PMID:20423157,18540824]. It also mediates transcription factor sequestering away from a gene promoter or tethering of the AhR to a transcription factor on a promoter. AHR calculated molecular masses differ by <10%, compared with the apparent molecular masses predicted from SDS-PAGE for the two receptors (105 and 95 kDa, respectively). (PMID: 8246913)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	NPJ Regen Med; Aryl hydrocarbon receptor regulates IL-22 receptor expression on thymic epithelial cell and accelerates thymus regeneration; Authors - Jingyi Shen
human	WB,IF	Phytother Res; Quercetin ameliorates ulcerative colitis by activating aryl hydrocarbon receptor to improve intestinal barrier integrity; Authors - Xiaojing Wang
		Cell Rep; Hypoxia-induced PRMT1 methylates HIF2β to promote breast tumorigenesis via enhancing glycolytic gene transcription; Authors - Wen-Juan Li
mouse	IF	Ecotoxicol Environ Saf; Hesperetin protects hippocampal neurons from the neurotoxicity of Aflatoxin B1 in mice; Authors - Chao Song
rat	WB	Biomater Sci; Glioma-targeted multifunctional nanoparticles to co-deliver camptothecin and curcumin for enhanced chemo-immunotherapy.; Authors - Zian Wang
mouse	WB,IF	iScience; StemRegenin 1 attenuates the RANKL-induced osteoclastogenesis via inhibiting AhR-c-src-NF-κB/p-ERK MAPK-NFATc1 signaling pathway; Authors - Shengji Zhou

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Rashmi (Verified Customer) (10-13-2025)

The antibody worked well (1:100 dilution) with IFA on paraffin-embedded mouse lung tissue.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:100
• Cell Tissue Type: Lung

AHR Antibody Immunofluorescence validation (1:100 dilution) in Lung (Cat no:67785-1-Ig)

FH

Bartosz (Verified Customer) (02-09-2023)

Perfect Abs, the bands are clear and very strong, even in case of small of amount of protein, loaded into gel (20 ug). Just perfect, highly recommend.

• Applications: Western Blot
• Primary Antibody Dilution: 1:3000
• Cell Tissue Type: SH-SY5Y cells; A549 cells; CACO-2 cells; BJ cells