AHR Monoclonal antibody, PBS Only

• 

  WB analysis using 67785-1-Ig (same clone as 67785-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67785-1-Ig (AHR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67785-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67785-1-Ig (same clone as 67785-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67785-1-Ig (AHR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67785-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 67785-1-Ig (same clone as 67785-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 67785-1-Ig (AHR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67785-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67785-1-Ig (same clone as 67785-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67785-1-Ig (AHR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67785-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 67785-1-Ig (same clone as 67785-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67785-1-Ig (AHR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67785-1-PBS in a different storage buffer formulation.

• 

  WB analysis of 4T1 using 67785-1-Ig (same clone as 67785-1-PBS)

  4T1 cells were subjected to SDS PAGE followed by western blot with 67785-1-Ig (AHR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67785-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67785-1-Ig (same clone as 67785-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67785-1-Ig (AHR antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67785-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67785-1-Ig (same clone as 67785-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67785-1-Ig (AHR antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67785-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human breast cancer using 67785-1-Ig (same clone as 67785-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human breast cancer tissue using AHR antibody (67785-1-Ig, Clone: 2D1F9 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). Blue (DAPI). This data was developed using the same antibody clone with 67785-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse testis using 67785-1-Ig (same clone as 67785-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using AHR antibody (67785-1-Ig, Clone: 2D1F9 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67785-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67785-1-Ig (same clone as 67785-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using AHR antibody (67785-1-Ig, Clone: 2D1F9 ) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 67785-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

AHR Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, Indirect ELISA

Cat No. 67785-1-PBS

Clone No.2D1F9

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, Indirect ELISA

Synonyms

Class E basic helix-loop-helix protein 76, bHLHe76, Ah receptor, 2D1F9

---

Product Information

67785-1-PBS targets AHR in WB, IHC, IF/ICC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28935

  Product name: Recombinant human AHR protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 25-300 aa of BC070080

  Sequence: PIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPSQCTESGQGIEEATGLPQTVVCYNPDQIPPENSPLMERCFICRLRCLLDNSSGFLAMNFQGKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGC

• Full Name: aryl hydrocarbon receptor
• Calculated Molecular Weight: 848 aa, 96 kDa
• Observed Molecular Weight: 105-110 kDa
• GenBank Accession Number: BC070080
• Gene Symbol: AHR
• Gene ID (NCBI): 196
• RRID: AB_2918549
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P35869
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The aryl hydrocarbon receptor (AhR) is a ligand-activated transcription factor that has been largely regarded as a mediator of xenobiotic metabolism [PMID:18483242]. It plays a part role in physiologic activities, including attenuation of the acute phase response, cytokine signaling, T helper (TH)17 immune cell differentiation, modulation of NF-κB activity, and regulation of hormonal signaling [PMID:20423157,18540824]. It also mediates transcription factor sequestering away from a gene promoter or tethering of the AhR to a transcription factor on a promoter. AHR calculated molecular masses differ by <10%, compared with the apparent molecular masses predicted from SDS-PAGE for the two receptors (105 and 95 kDa, respectively). (PMID: 8246913)