AHR Monoclonal antibody, PBS Only

Name: AHR Monoclonal antibody, PBS Only, 100ug
Brand: Proteintech
SKU: 67785-1-PBS-100UG

AHR Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 67785-1-PBS

Clone No. 2D1F9

Review Product

Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

2D1F9, Ah receptor, bHLHe76, Class E basic helix-loop-helix protein 76

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIF/ICC

WB analysis using 67785-1-Ig (same clone as 67785-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67785-1-Ig (AHR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67785-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 67785-1-Ig (same clone as 67785-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67785-1-Ig (AHR antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67785-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 67785-1-Ig (same clone as 67785-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67785-1-Ig (AHR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67785-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of MCF-7 using 67785-1-Ig (same clone as 67785-1-PBS)
MCF-7 cells were subjected to SDS PAGE followed by western blot with 67785-1-Ig (AHR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67785-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 67785-1-Ig (same clone as 67785-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67785-1-Ig (AHR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67785-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HSC-T6 using 67785-1-Ig (same clone as 67785-1-PBS)
HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67785-1-Ig (AHR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67785-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of 4T1 using 67785-1-Ig (same clone as 67785-1-PBS)
4T1 cells were subjected to SDS PAGE followed by western blot with 67785-1-Ig (AHR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67785-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 67785-1-Ig (same clone as 67785-1-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using AHR antibody (67785-1-Ig, Clone: 2D1F9 ) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 67785-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for AHR in ?

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

67785-1-PBS targets AHR in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Mouse / IgG2b
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag28935 Product name: Recombinant human AHR protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 25-300 aa of BC070080 Sequence: PIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPSQCTESGQGIEEATGLPQTVVCYNPDQIPPENSPLMERCFICRLRCLLDNSSGFLAMNFQGKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGC Predict reactive species
Full Name	aryl hydrocarbon receptor
Calculated Molecular Weight	848 aa, 96 kDa
Observed Molecular Weight	105-110 kDa
GenBank Accession Number	BC070080
Gene Symbol	AHR
Gene ID (NCBI)	196
RRID	AB_2918549
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P35869
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

The aryl hydrocarbon receptor (AhR) is a ligand-activated transcription factor that has been largely regarded as a mediator of xenobiotic metabolism [PMID:18483242]. It plays a part role in physiologic activities, including attenuation of the acute phase response, cytokine signaling, T helper (TH)17 immune cell differentiation, modulation of NF-κB activity, and regulation of hormonal signaling [PMID:20423157,18540824]. It also mediates transcription factor sequestering away from a gene promoter or tethering of the AhR to a transcription factor on a promoter. AHR calculated molecular masses differ by <10%, compared with the apparent molecular masses predicted from SDS-PAGE for the two receptors (105 and 95 kDa, respectively). (PMID: 8246913)