AKAP4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• AKAP4 Polyclonal antibody (24986-1-AP)

AKAP4 Polyclonal Antibody for WB, ELISA

Cat No. 24986-1-AP Copied!

Publications (11)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IF, ELISA

Synonyms

AKAP-4, AKAP82, A-kinase anchor protein 4, A-kinase anchor protein 82 kDa, hAKAP82

• 

  WB analysis of human testis using 24986-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 24986-1-AP (AKAP4 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for AKAP4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24986-1-AP targets AKAP4 in WB, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21762

  Product name: Recombinant human AKAP4 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 565-693 aa of BC126252

  Sequence: TCEEDCPGSTMGYMAQSTQYEKCGGGQSAKALSVKQLESHRAPGPSTCQKENQHLDSQKMDMSNIVLMLIQKLLNENPFKCEDPCEGENKCSEPRASKAASMSNRSDKAEEQCQEHQELDCTSGMKQAN

• Full Name: A kinase (PRKA) anchor protein 4
• Calculated Molecular Weight: 854 aa, 94 kDa
• Observed Molecular Weight: 82 kDa
• GenBank Accession Number: BC126252
• Gene Symbol: AKAP4
• Gene ID (NCBI): 8852
• RRID: AB_2876859
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5JQC9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AKAP4, also named as A-kinase anchor protein 82 kDa, is a 854 amino acid protein, which belongs to the AKAP110 family. AKAP4 localizes to the principle piece of the sperm flagellum and is only expressed in round spermatids. AKAP4 is a major structural component of sperm fibrous sheath and plays a role in sperm motility.

Publications

What published studies show

The AKAP4 Polyclonal antibody (Cat# 24986-1-AP) has 11 total citations. Citations appear in Science China Life Sciences, PNAS, J Anim Sci Biotechnol, Front Endocrinol, Front Cell Dev Biol, Animals, Life Sci Alliance, Asian J Androl, Transl Androl Urol, and Andrologia. Research fields span sperm flagellar biology, male infertility, reproductive medicine, and breast cancer.

Automatically generated from the 11 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Sci China Life Sci; Adenylate kinase phosphate energy shuttle underlies energetic communication in flagellar axonemes; Authors - Huan Wu
human	WB	Proc Natl Acad Sci U S A; FSIP1 binds HER2 directly to regulate breast cancer growth and invasiveness.; Authors - Tong Liu
bovine	IF	J Anim Sci Biotechnol; Dissecting the development of bovine testicular tissue using spatial transcriptomics.; Authors - Haoyan Jin
human	WB	Front Endocrinol (Lausanne); Alterations in the protein lactylation landscape of sperm from patients with varicocele-associated asthenozoospermia.; Authors - Heran Cao
	WB	Front Cell Dev Biol; Comparative Proteomics and Phosphoproteomics Analysis Reveal the Possible Breed Difference in Yorkshire and Duroc Boar Spermatozoa.; Authors - Yongjie Xu
	WB	Animals (Basel); Comparative Study on the Sperm Proteomes of Horses and Donkeys; Authors - Hong Ren