Tested Applications
| Positive WB detected in | human testis tissue |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IF | See 2 publications below |
Product Information
24986-1-AP targets AKAP4 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21762 Product name: Recombinant human AKAP4 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 565-693 aa of BC126252 Sequence: TCEEDCPGSTMGYMAQSTQYEKCGGGQSAKALSVKQLESHRAPGPSTCQKENQHLDSQKMDMSNIVLMLIQKLLNENPFKCEDPCEGENKCSEPRASKAASMSNRSDKAEEQCQEHQELDCTSGMKQAN Predict reactive species |
| Full Name | A kinase (PRKA) anchor protein 4 |
| Calculated Molecular Weight | 854 aa, 94 kDa |
| Observed Molecular Weight | 82 kDa |
| GenBank Accession Number | BC126252 |
| Gene Symbol | AKAP4 |
| Gene ID (NCBI) | 8852 |
| RRID | AB_2876859 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q5JQC9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
AKAP4, also named as A-kinase anchor protein 82 kDa, is a 854 amino acid protein, which belongs to the AKAP110 family. AKAP4 localizes to the principle piece of the sperm flagellum and is only expressed in round spermatids. AKAP4 is a major structural component of sperm fibrous sheath and plays a role in sperm motility.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for AKAP4 antibody 24986-1-AP | Download protocol |
| WB protocol for AKAP4 antibody 24986-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Proc Natl Acad Sci U S A FSIP1 binds HER2 directly to regulate breast cancer growth and invasiveness. | ||
Front Cell Dev Biol Comparative Proteomics and Phosphoproteomics Analysis Reveal the Possible Breed Difference in Yorkshire and Duroc Boar Spermatozoa. | ||
Andrologia Successful outcomes of intracytoplasmic sperm injection-embryo transfer using ejaculated spermatozoa from two Chinese asthenoteratozoospermic brothers with a compound heterozygous FSIP2 mutation. | ||
Life Sci Alliance Genetic mutation of Cep76 results in male infertility due to abnormal sperm tail composition | ||
Sci China Life Sci Adenylate kinase phosphate energy shuttle underlies energetic communication in flagellar axonemes |





