AKR1B1 Monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 67498-1-Ig (same clone as 67498-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 67498-1-Ig (AKR1B1 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67498-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67498-1-Ig (same clone as 67498-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67498-1-Ig (AKR1B1 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67498-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 67498-1-Ig (same clone as 67498-1-PBS)

  WB result of AKR1B1 antibody (67498-1-Ig; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-AKR1B1 transfected HepG2 cells. This data was developed using the same antibody clone with 67498-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 67498-1-Ig (same clone as 67498-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67498-1-Ig (AKR1B1 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67498-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 67498-1-Ig (same clone as 67498-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67498-1-Ig (AKR1B1 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67498-1-PBS in a different storage buffer formulation.

• 

  WB analysis of 4T1 using 67498-1-Ig (same clone as 67498-1-PBS)

  4T1 cells were subjected to SDS PAGE followed by western blot with 67498-1-Ig (AKR1B1 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67498-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 67498-1-Ig (same clone as 67498-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67498-1-Ig (AKR1B1 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67498-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human bladder using 67498-1-Ig (same clone as 67498-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human bladder tissue slide using 67498-1-Ig (AKR1B1 antibody) at dilution of 1:500 (under 10x lens).. This data was developed using the same antibody clone with 67498-1-PBS in a different storage buffer formulation.

• 

  IF Staining of BxPC-3 using 67498-1-Ig (same clone as 67498-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed BxPC-3 cells using AKR1B1 antibody (67498-1-Ig, Clone: 2F11G5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67498-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

AKR1B1 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67498-1-PBS

Clone No.2F11G5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

2F11G5, AKR1B 1, Aldo-keto reductase family 1 member B1, ALDR1, ALR2

---

Product Information

67498-1-PBS targets AKR1B1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7571

  Product name: Recombinant human AKR1B1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-316 aa of BC000260

  Sequence: MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF

• Full Name: aldo-keto reductase family 1, member B1 (aldose reductase)
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC000260
• Gene Symbol: AKR1B1
• Gene ID (NCBI): 231
• RRID: AB_2882722
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P15121
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.