Recombinant human ALDH1A1 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag17358
Synonyms
ALDH1A1, 3-deoxyglucosone dehydrogenase, ALDC, Aldehyde dehydrogenase 1A1, ALDH 1A1
Validation Data Gallery View All
Product Information
| Peptide Sequence |
GPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQA
(403-449 aa encoded by BC001505) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
