• Featured Product
  • KD/KO Validated

AMOTL2 Polyclonal antibody

AMOTL2 Polyclonal Antibody for WB, ELISA
Cat No. 23351-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF, CoIP, ELISA

AMOTL2, angiomotin like 2, Angiomotin like protein 2, KIAA0989, LCCP, Leman coiled coil protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

23351-1-AP targets AMOTL2 in WB, IF, CoIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19953

Product name: Recombinant human AMOTL2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 340-466 aa of BC011454

Sequence: DPGKAIQGSLRPAKSVPSVFAAAAAGTQGWQGLSSSERQTADAPARLTTDRAPTEEPVVTAPPAAHAKHGSRDGSTQTEGPPDSTSTCLPPEPDSLLGCSSSQRAASLDSVATSRVQDLSDMVEILI

Predict reactive species
Full Name angiomotin like 2
Calculated Molecular Weight 779 aa, 86 kDa
Observed Molecular Weight 100 kDa
GenBank Accession NumberBC011454
Gene Symbol AMOTL2
Gene ID (NCBI) 51421
RRIDAB_2879263
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9Y2J4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Angiomotin‑like 2 (AMOTL2) is a member of the motin family of angiostatin‑binding proteins. The motin family, also known as AMOTs, consists of three members: AMOT, AMOT-like 1 (AMOTL1) and AMOTL2. Members of the motin family are a type of adaptor proteins mainly distributed in the cytomembrane, cytoplasm or nucleus, and have a higher expression in the endothelial cells of capillaries and in larger vessels of the placenta. Human AmotL2 encodes two isoforms of a molecular mass of 100 kDa and 60 kDa.(PMID: 34036399,PMID: 25080976)

Protocols

Product Specific Protocols
WB protocol for AMOTL2 antibody 23351-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Mol Ther Nucleic Acids

Hsa_circ_0024093 accelerates VSMC proliferation via miR-4677-3p/miR-889-3p/USP9X/YAP1 axis in in vitro model of lower extremity ASO.

Authors - Xue Zhang
humanWB

Mol Ther Nucleic Acids

Hypoxic Tumor-Derived Exosomal Long Noncoding RNA UCA1 Promotes Angiogenesis via miR-96-5p/AMOTL2 in Pancreatic Cancer.

Authors - Zengya Guo
  • KD Validated
humanWB

Arthritis Res Ther

Regulation of type I interferon signature by VGLL3 in the fibroblast-like synoviocytes of rheumatoid arthritis patients via targeting the Hippo pathway

Authors - Yu Du
humanWB

Sci Rep

MAGI1 inhibits the AMOTL2/p38 stress pathway and prevents luminal breast tumorigenesis.

Authors - Diala Kantar
  • KD Validated
humanWB

Mol Biol Cell

AMOT130 drives BMP-SMAD signaling at the apical membrane in polarized cells.

Authors - Patrizia Brunner
  • KD Validated
humanWB

Pharmaceuticals (Basel)

Comparative Assessment and High-Throughput Drug-Combination Profiling of TEAD-Palmitoylation Inhibitors in Hippo Pathway Deficient Mesothelioma

Authors - Lale Evsen

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Florian (Verified Customer) (10-13-2021)

10% SDS-PAGE 1st AB incubation ON

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Human breast cancer cell line (HCC1806)
AMOTL2 Antibody Western Blot validation (1:500 dilution) in Human breast cancer cell line (HCC1806) (Cat no:23351-1-AP)
FH

Lisa (Verified Customer) (07-08-2020)

Two specific bands (60 and 100 kDa) and two others non specific.This antibody is working by WB.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/600
  • Cell Tissue Type: MCF7 cell line
AMOTL2 Antibody Western Blot validation (1/600 dilution) in MCF7 cell line (Cat no:23351-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...