Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

ANGPTL7 Polyclonal antibody

ANGPTL7 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, ELISA

Angiopoietin-like protein 7, Angiopoietin-like factor, Angiopoietin related protein 7, Angiopoietin like protein 7, Angiopoietin like factor

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for ANGPTL7 in ?

Tested Applications

Positive WB detected inHepG2 cells, MCF-7 cells
Positive IHC detected inhuman liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inTHP-1 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10396-1-AP targets ANGPTL7 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0596

Product name: Recombinant human ANGPTL7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 44-334 aa of BC001881

Sequence: NCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKR

Predict reactive species
Full Name angiopoietin-like 7
Calculated Molecular Weight 40 kDa
Observed Molecular Weight 45 kDa
GenBank Accession NumberBC001881
Gene Symbol ANGPTL7
Gene ID (NCBI) 10218
RRIDAB_2057556
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO43827
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ANGPTL7, also named as CDT6, is a member of the angiopoietin-like (ANGPTL) family of proteins, which are important regulators of Angiogenesis. It is a secreted 45-kDa glycoprotein that folds into a homotetramer structure linked by disulfide bonds. ANGPTL7 was originally discovered in the stromal layer of the corne, and moderately expressed in the human trabecular meshwork. The chromosomal location of the ANGPTL7 gene (1p36.22) is within the GLC3B locus (1p36.2-1p36.1) of primary congenital glaucoma, supporting ANGPTL7 as a candidate glaucoma gene. ANGPTL7 could have a pathogenic role in glaucoma, and may serve as a potential therapeutic target.

Protocols

Product Specific Protocols
WB protocol for ANGPTL7 antibody 10396-1-APDownload protocol
IF protocol for ANGPTL7 antibody 10396-1-APDownload protocol
IHC protocol for ANGPTL7 antibody 10396-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The ANGPTL7 antibody (Cat# 10396-1-AP) has 13 citations published in journals including Nature Communications, Osteoarthritis and Cartilage, FASEB Journal, Communications Biology, Frontiers in Immunology, Frontiers in Pharmacology, Frontiers in Cell and Developmental Biology, Frontiers in Molecular Biosciences, Journal of Proteome Research, Human Molecular Genetics, Frontiers in Cardiovascular Medicine, and Genes & Cells. Associated research fields include glaucoma, osteoarthritis, pancreatic cancer pain, Alzheimer's disease, esophageal carcinoma, insulin resistance/diabetes, fatty liver disease, age-related macular degeneration, coronary artery disease, and thyroid eye disease.

SpeciesApplicationTitle
mouseIF

Nat Commun

Tumor-derived GDF15 induces CCN3⁺ Schwann cells to promote cancer pain in pancreatic cancer.

Authors - Guojun Chen
mouseIF

Osteoarthritis Cartilage

Effects of mechanical stress and deficiency of dihydrotestosterone or 17β-estradiol on Temporomandibular Joint Osteoarthritis in mice.

Authors - T Ootake
humanIHC

Front Immunol

Oxidative stress-related biomarkers in thyroid eye disease: evidence from bioinformatics analysis and experimental validation.

Authors - Yuanping Hai
humanWB

Commun Biol

ANGPTL7, a therapeutic target for increased intraocular pressure and glaucoma

Authors - Kavita Praveen
human, ratIF

Front Pharmacol

PDGF-BB inhibits SP1/Angptl7 mediated chondro-endothelial crosstalk via stress-sensitivity Piezo1 regulation in osteoarthritis.

Authors - Zhengchao Wang
WB

Front Cell Dev Biol

Fangchinoline alleviates cognitive impairments through enhancing autophagy and mitigating oxidative stress in Alzheimer's disease models

Authors - Lilin Yi

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer (Kenzo Oikawa) rated this antibody 5/5 stars for immunofluorescence on frozen mouse eye sections at a 1:500 dilution. He reported that the antibody worked well for his application. Overall, the single review reflects a positive experience with the product performing as expected in IF.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Kenzo (Verified Customer) (01-05-2024)

The antibody worked well for immunofluorescence on frozen mouse eye sections.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Eye
Loading...
||
New chat

Able™

正在加载,请稍候...