Tested Applications
| Positive WB detected in | HepG2 cells, MCF-7 cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10396-1-AP targets ANGPTL7 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0596 Product name: Recombinant human ANGPTL7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 44-334 aa of BC001881 Sequence: NCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKR Predict reactive species |
| Full Name | angiopoietin-like 7 |
| Calculated Molecular Weight | 40 kDa |
| Observed Molecular Weight | 45 kDa |
| GenBank Accession Number | BC001881 |
| Gene Symbol | ANGPTL7 |
| Gene ID (NCBI) | 10218 |
| RRID | AB_2057556 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43827 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ANGPTL7, also named as CDT6, is a member of the angiopoietin-like (ANGPTL) family of proteins, which are important regulators of Angiogenesis. It is a secreted 45-kDa glycoprotein that folds into a homotetramer structure linked by disulfide bonds. ANGPTL7 was originally discovered in the stromal layer of the corne, and moderately expressed in the human trabecular meshwork. The chromosomal location of the ANGPTL7 gene (1p36.22) is within the GLC3B locus (1p36.2-1p36.1) of primary congenital glaucoma, supporting ANGPTL7 as a candidate glaucoma gene. ANGPTL7 could have a pathogenic role in glaucoma, and may serve as a potential therapeutic target.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ANGPTL7 antibody 10396-1-AP | Download protocol |
| IF protocol for ANGPTL7 antibody 10396-1-AP | Download protocol |
| IHC protocol for ANGPTL7 antibody 10396-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ANGPTL7 antibody (Cat# 10396-1-AP) has 13 citations published in journals including Nature Communications, Osteoarthritis and Cartilage, FASEB Journal, Communications Biology, Frontiers in Immunology, Frontiers in Pharmacology, Frontiers in Cell and Developmental Biology, Frontiers in Molecular Biosciences, Journal of Proteome Research, Human Molecular Genetics, Frontiers in Cardiovascular Medicine, and Genes & Cells. Associated research fields include glaucoma, osteoarthritis, pancreatic cancer pain, Alzheimer's disease, esophageal carcinoma, insulin resistance/diabetes, fatty liver disease, age-related macular degeneration, coronary artery disease, and thyroid eye disease.
| Species | Application | Title |
|---|---|---|
Nat Commun Tumor-derived GDF15 induces CCN3⁺ Schwann cells to promote cancer pain in pancreatic cancer. | ||
Osteoarthritis Cartilage Effects of mechanical stress and deficiency of dihydrotestosterone or 17β-estradiol on Temporomandibular Joint Osteoarthritis in mice. | ||
Front Immunol Oxidative stress-related biomarkers in thyroid eye disease: evidence from bioinformatics analysis and experimental validation. | ||
Commun Biol ANGPTL7, a therapeutic target for increased intraocular pressure and glaucoma | ||
Front Pharmacol PDGF-BB inhibits SP1/Angptl7 mediated chondro-endothelial crosstalk via stress-sensitivity Piezo1 regulation in osteoarthritis. | ||
Front Cell Dev Biol Fangchinoline alleviates cognitive impairments through enhancing autophagy and mitigating oxidative stress in Alzheimer's disease models |
Reviews
What customers say
One reviewer (Kenzo Oikawa) rated this antibody 5/5 stars for immunofluorescence on frozen mouse eye sections at a 1:500 dilution. He reported that the antibody worked well for his application. Overall, the single review reflects a positive experience with the product performing as expected in IF.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Kenzo (Verified Customer) (01-05-2024) | The antibody worked well for immunofluorescence on frozen mouse eye sections.
|
