ANKRD2 Polyclonal antibody

• 

  WB analysis of mouse skeletal muscle using 11821-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 11821-1-AP (ANKRD2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 11821-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11821-1-AP (ANKRD2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human skeletal muscle using 11821-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 11821-1-AP (ANKRD2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse skeletal muscle using 11821-1-AP

  IP result of anti-ANKRD2 (IP:11821-1-AP, 4ug; Detection:11821-1-AP 1:500) with mouse skeletal muscle tissue lysate 3600ug.

• 

  IHC staining of human kidney using 11821-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 11821-1-AP (ANKRD2 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human kidney using 11821-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 11821-1-AP (ANKRD2 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human testis using 11821-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 11821-1-AP (ANKRD2 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human testis using 11821-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 11821-1-AP (ANKRD2 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human skin using 11821-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 11821-1-AP (ANKRD2 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human skin using 11821-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 11821-1-AP (ANKRD2 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human brain using 11821-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 11821-1-AP (ANKRD2 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human brain using 11821-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 11821-1-AP (ANKRD2 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human lung using 11821-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 11821-1-AP (ANKRD2 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human lung using 11821-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 11821-1-AP (ANKRD2 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human skeletal muscle using 11821-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle slide using 11821-1-AP (ANKRD2 Antibody) at dilution of 1:50.

• 

  IHC staining of human skeletal muscle using 11821-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle slide using 11821-1-AP (ANKRD2 Antibody) at dilution of 1:50.

• 

  IF Staining of HeLa using 11821-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using ANKRD2 antibody (11821-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

• Featured Product
• KD/KO Validated

ANKRD2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11821-1-AP

Publications(11)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Ankyrin repeat domain-containing protein 2, ARPP, hArpp

---

Tested Applications

• Positive WB detected in: HEK-293 cells, human skeletal muscle tissue, mouse skeletal muscle tissue
• Positive IP detected in: mouse skeletal muscle tissue
• Positive IHC detected in: human kidney tissue, human lung tissue, human skeletal muscle tissue, human testis tissue, human brain tissue, human skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 9 publications below
• IHC: See 1 publications below
• IF: See 3 publications below

Product Information

11821-1-AP targets ANKRD2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2389

  Product name: Recombinant human ANKRD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-303 aa of BC020817

  Sequence: EAVMDGTMEDSEAVQRATALIEQRLAQEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRDALAASHEPPPEPEEITGPVDEETFLKAAVEGKMKVIEKFLADGGSADTCDQFRRTALHRASLEGHMEILEKLLDNGATVDFQDRLDCTAMHWACRGGHLEVVKLLQSHGADTNVRDKEGDTALHDAVRLNRYKIIKLLLLHGADMMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSGRETPQPVPAQ

• Full Name: ankyrin repeat domain 2 (stretch responsive muscle)
• Calculated Molecular Weight: 37 aa, 2 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC020817
• Gene Symbol: ANKRD2
• Gene ID (NCBI): 26287
• RRID: AB_2057858
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9GZV1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ANKRD2 belongs to the conserved muscle ankyrin repeat protein (MARP) family. Expression of MARPs is induced in response to physiologic stress, injury, and hypertrophy. Together with Ankrd1/CARP and DARP, ANKRD2 are members of the MARP mechanosensing proteins that form a complex with titin (N2A)/calpain 3 protease/myopalladin. Ankrd2 is thought to have dual, structural and signaling roles, and could link the elastic I-band region as a stress sensor for transcriptional control in the nucleus

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	PLoS BIOLOGY; Integrated transcriptomics and epigenomics reveal chamber-specific and species-specific characteristics of human and mouse hearts; Authors - Junpeng Gao
human	WB,IF	Cancers (Basel); Ectopic Expression of Ankrd2 Affects Proliferation, Motility and Clonogenic Potential of Human Osteosarcoma Cells.; Authors - Manuela Piazzi ; KD Validated
mouse	IF	Cell Death Dis; The histone code reader Spin1 controls skeletal muscle development.; Authors - Holger Greschik
mouse	WB	Mol Biol Cell; Ankrd2/ARPP is a novel Akt2 specific substrate and regulates myogenic differentiation upon cellular exposure to H(2)O(2).; Authors - Cenni Vittoria V
mouse	WB	Pharmaceuticals (Basel); Metronomic 5-Fluorouracil Delivery Primes Skeletal Muscle for Myopathy but Does Not Cause Cachexia.; Authors - Dean G Campelj
mouse	WB	J Appl Physiol; Early depression of Ankrd2 and Csrp3 mRNAs in the polyribosomal and whole tissue fractions in skeletal muscle with decreased voluntary running.; Authors - Roberts Michael D MD