AP2B1 Polyclonal antibody

• 

  WB analysis using 15690-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15690-1-AP (AP2B1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 15690-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 15690-1-AP (AP2B1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of C6 using 15690-1-AP

  C6 cells were subjected to SDS PAGE followed by western blot with 15690-1-AP (AP2B1 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 15690-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 15690-1-AP (AP2B1 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of K-562 using 15690-1-AP

  IP result of anti-AP2B1 (IP:15690-1-AP, 4ug; Detection:15690-1-AP 1:500) with K-562 cells lysate 3200ug.

• 

  IF Staining of HeLa using 15690-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using AP2B1 antibody (15690-1-AP) at dilution of 1:2000 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

AP2B1 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 15690-1-AP

Publications(15)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IF/ICC, IP, ELISA

Synonyms

Beta-2-adaptin, AP-2 complex subunit beta, AP 2 complex subunit beta, ADTB2, Adaptor-related protein complex 2 subunit beta

---

Tested Applications

• Positive WB detected in: HeLa cells, SH-SY5Y cells, K-562 cells, C6 cells, NIH/3T3 cells
• Positive IP detected in: K-562 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 13 publications below
• IF: See 4 publications below

Product Information

15690-1-AP targets AP2B1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, pig, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8248

  Product name: Recombinant human AP2B1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 598-951 aa of BC006201

  Sequence: GSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN

• Full Name: adaptor-related protein complex 2, beta 1 subunit
• Calculated Molecular Weight: 105 kDa
• Observed Molecular Weight: 100-105 kDa
• GenBank Accession Number: BC006201
• Gene Symbol: AP2B1
• Gene ID (NCBI): 163
• RRID: AB_2056351
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P63010
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AP2B1 is a component of the adaptor protein complex 2 (AP-2). AP complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP complexes are involved in the formation of clathrin-coated vesicles (CCVs) by recruiting the scaffold protein, clathrin. AP complexes also play a pivotal role in the cargo selection by recognizing the sorting signals within the cytoplasmic tail of integral membrane proteins. AP-2 works on the plasma membrane to internalize cargo in clathrin-mediated endocytosis.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
pig	WB	Emerg Microbes Infect; CD1d facilitates African swine fever virus entry into the host cells via clathrin-mediated endocytosis; Authors - Xin Chen
	WB	Elife; Syncytin-mediated open-ended membrane tubular connections facilitate the intercellular transfer of cargos including Cas9 protein; Authors - Congyan Zhang
pig	WB	PLoS Pathog; Pseudorabies virus inhibits progesterone-induced inactivation of TRPML1 to facilitate viral entry; Authors - Bing-Qian Su
pig	WB,IF	Sci China Life Sci; NPC1-regulated dynamic of clathrin-coated pits is essential for viral entry.; Authors - Guoli Li
human	WB	J Virol; The G protein-coupled receptor FFAR2 promotes internalization during influenza A virus entry.; Authors - Guangwen Wang ; KD Validated
pig	WB	Viruses; Pseudorabies Virus Inhibits Expression of Liver X Receptors to Assist Viral Infection.; Authors - Yi Wang