Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Apolipoprotein AI Polyclonal antibody

Apolipoprotein AI Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA

APOA1, apolipoprotein A I, APOA 1, ApoA I, ApoAI

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Apolipoprotein AI in ?

Tested Applications

Positive WB detected inHepG2 cells, human brain tissue, human ileum tissue, human plasma, mouse liver tissue
Positive IHC detected inhuman liver cancer tissue, human liver tissue, human lung tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse liver tissue
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14427-1-AP targets Apolipoprotein AI in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5793

Product name: Recombinant human APOA1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 19-267 aa of BC005380

Sequence: RHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ

Predict reactive species
Full Name apolipoprotein A-I
Calculated Molecular Weight 31 kDa
Observed Molecular Weight 26-30 kDa
GenBank Accession NumberBC005380
Gene Symbol APOA1
Gene ID (NCBI) 335
RRIDAB_2056524
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP02647
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ApoA1 is a major protein component of high density lipoproteins (HDL) which is associated with reversed cholesterol transport, lipid/cholesterol binding, lecithin/cholesterol acyltransferase (LCAT) activation and specific receptors binding. It is synthesized in the liver and small intestine. Defects of ApoA1 cause low HDL level and systemic non-neuropathic amyloidosis. Serum concentration of ApoA1 is inversely related to the risk of developing atherosclerosis. This antibody was generated against the C-terminal region of human ApoA1.

Protocols

Product Specific Protocols
FC protocol for Apolipoprotein AI antibody 14427-1-APDownload protocol
IF protocol for Apolipoprotein AI antibody 14427-1-APDownload protocol
IHC protocol for Apolipoprotein AI antibody 14427-1-APDownload protocol
WB protocol for Apolipoprotein AI antibody 14427-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-Apolipoprotein A-I antibody (Cat# 14427-1-AP) has accumulated 59 citations across high-impact journals including Science, Neuron, Cell Discovery, Metabolism, Theranostics, Biomaterials, Hypertension, Diabetes, Free Radical Biology and Medicine, and Journal of Biological Chemistry. Research fields span atherosclerosis, lipid metabolism, liver disease, extracellular vesicles, cancer, cardiovascular disease, diabetes, and neuroinflammation.

SpeciesApplicationTitle
IP

Science

Enterically derived high-density lipoprotein restrains liver injury through the portal vein.

Authors - Yong-Hyun Han
mouseIF

Cell Discov

Single-cell transcriptomics reveals intestinal cell heterogeneity and identifies Ep300 as a potential therapeutic target in mice with acute liver failure

Authors - Jie Yin
mouseWB,IP

Neuron

Astrocytic ApoE reprograms neuronal cholesterol metabolism and histone-acetylation-mediated memory.

Authors - Xiaohui Li
mouseWB

Metabolism

Inhibiting IP6K1 confers atheroprotection by elevating circulating apolipoprotein A-I

Authors - Xiaoqi Liu
humanWB

J Nanobiotechnology

COPD airway epithelial cells-derived extracellular vesicles contribute to endothelial dysfunction and atherosclerosis via the miR-141-3p/PDCD4 axis.

Authors - Zihan Wang
humanWB

Theranostics

Exosome-mediated delivery of inflammation-responsive Il-10 mRNA for controlled atherosclerosis treatment

Authors - Te Bu

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The single review for this product is highly positive, rated 5 out of 5 stars. The reviewer used it at a 1:1000 dilution for Western Blot and Immunoprecipitation on HepG2 cells and mouse liver tissue. They confirmed successful detection of both human and mouse APOA1 protein by Western blot, as well as effective immunoprecipitation of APOA1 from both species, demonstrating reliable cross-reactivity across human and mouse samples.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Alexandre (Verified Customer) (02-28-2019)

Detection of both human and mouse APOA1 protein by westernblotImmunoprecipitation of both human and mouse APOA1

  • Applications: Western Blot, Immunoprecipitation,
  • Primary Antibody Dilution: WB 1/1000
  • Cell Tissue Type: HepG2 / Mouse Liver
Apolipoprotein AI Antibody Western Blot,Immunoprecipitation, validation (WB 1/1000 dilution) in HepG2 / Mouse Liver (Cat no:14427-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...