Apolipoprotein AI Polyclonal antibody

• 

  WB analysis of human plasma using 14427-1-AP

  human blood were subjected to SDS PAGE followed by western blot with 14427-1-AP (Apolipoprotein AI antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 14427-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 14427-1-AP (Apolipoprotein AI antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human ileum using 14427-1-AP

  human ileum tissue were subjected to SDS PAGE followed by western blot with 14427-1-AP (Apolipoprotein AI antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 14427-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14427-1-AP (Apolipoprotein AI antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 14427-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14427-1-AP (Apolipoprotein AI antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 14427-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 14427-1-AP (Apolipoprotein AI antibody at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human liver using 14427-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 14427-1-AP (Apolipoprotein AI antibody at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human lung using 14427-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 14427-1-AP (Apolipoprotein AI antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human lung using 14427-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 14427-1-AP (Apolipoprotein AI antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of mouse liver using 14427-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse liver tissue using Apolipoprotein AI antibody (14427-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of mouse liver using 14427-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse liver tissue using Apolipoprotein AI antibody (14427-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HeLa using 14427-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using Apolipoprotein AI antibody (14427-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  FC experiment of HepG2 using 14427-1-AP

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug Anti-Human Apolipoprotein AI (14427-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

Apolipoprotein AI Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

Cat No. 14427-1-AP

Publications(42)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA

Synonyms

APOA1, apolipoprotein A I, APOA 1, ApoA I, ApoAI

---

Tested Applications

• Positive WB detected in: human blood tissue, human brain tissue, human plasma, human ileum tissue
• Positive IHC detected in: human liver cancer tissue, human liver tissue, human lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse liver tissue
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 33 publications below
• IHC: See 10 publications below
• IF: See 4 publications below
• IP: See 2 publications below

Product Information

14427-1-AP targets Apolipoprotein AI in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5793

  Product name: Recombinant human APOA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 19-267 aa of BC005380

  Sequence: RHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ

• Full Name: apolipoprotein A-I
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: 26-30 kDa
• GenBank Accession Number: BC005380
• Gene Symbol: APOA1
• Gene ID (NCBI): 335
• RRID: AB_2056524
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P02647
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ApoA1 is a major protein component of high density lipoproteins (HDL) which is associated with reversed cholesterol transport, lipid/cholesterol binding, lecithin/cholesterol acyltransferase (LCAT) activation and specific receptors binding. It is synthesized in the liver and small intestine. Defects of ApoA1 cause low HDL level and systemic non-neuropathic amyloidosis. Serum concentration of ApoA1 is inversely related to the risk of developing atherosclerosis. This antibody was generated against the C-terminal region of human ApoA1.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IP	Science; Enterically derived high-density lipoprotein restrains liver injury through the portal vein.; Authors - Yong-Hyun Han
mouse	WB,IP	Neuron; Astrocytic ApoE reprograms neuronal cholesterol metabolism and histone-acetylation-mediated memory.; Authors - Xiaohui Li
mouse	WB	J Control Release; Lipid-mediated protein corona regulation with increased apolipoprotein A-I recruitment for glioma targeting; Authors - Yiwei Zhang
human	IHC	Br J Cancer; A new panel of pancreatic cancer biomarkers discovered using a mass spectrometry-based pipeline.; Authors - Xiaohui Liu
human	WB	Theranostics; Exosome-mediated delivery of inflammation-responsive Il-10 mRNA for controlled atherosclerosis treatment; Authors - Te Bu
		Br J Pharmacol; A novel apoA-I mimetic peptide suppresses atherosclerosis by promoting physiological HDL function in apoE-/- mice.; Authors - Sanhu Gou

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Alexandre (Verified Customer) (02-28-2019)

Detection of both human and mouse APOA1 protein by westernblotImmunoprecipitation of both human and mouse APOA1

• Applications: Western Blot, Immunoprecipitation,
• Primary Antibody Dilution: WB 1/1000
• Cell Tissue Type: HepG2 / Mouse Liver

Apolipoprotein AI Antibody Western Blot,Immunoprecipitation, validation (WB 1/1000 dilution) in HepG2 / Mouse Liver (Cat no:14427-1-AP)