Apolipoprotein AI Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of HepG2 using 83504-1-RR (same clone as 83504-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 83504-1-RR (Apolipoprotein AI antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83504-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 83504-1-RR (same clone as 83504-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 83504-1-RR (Apolipoprotein AI antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer(pH9). This data was developed using the same antibody clone with 83504-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 83504-1-RR (same clone as 83504-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using Apolipoprotein AI antibody (83504-1-RR, Clone: 240269F1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 83504-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 83504-1-RR (same clone as 83504-1-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug Apolipoprotein AI Recombinant antibody (83504-1-RR, Clone:240269F1) and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 83504-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83504-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83504-1-RR against Human Apolipoprotein AI were performed. The affinity constant is 4.05 nM.

Apolipoprotein AI Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 83504-1-PBS

Clone No.240269F1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

APOA1, apolipoprotein A I, 240269F1, APOA 1, ApoA I

---

Product Information

83504-1-PBS targets Apolipoprotein AI in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0757

  Product name: Recombinant Human APOA1 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 25-267 aa of BC005380

  Sequence: DEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ

• Full Name: apolipoprotein A-I
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: 26-30 kDa
• GenBank Accession Number: BC005380
• Gene Symbol: APOA1
• Gene ID (NCBI): 335
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P02647
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ApoA1 is a major protein component of high density lipoproteins (HDL) which is associated with reversed cholesterol transport, lipid/cholesterol binding, lecithin/cholesterol acyltransferase (LCAT) activation and specific receptors binding. It is synthesized in the liver and small intestine. Defects of ApoA1 cause low HDL level and systemic non-neuropathic amyloidosis. Serum concentration of ApoA1 is inversely related to the risk of developing atherosclerosis.