APOE Polyclonal antibody

• 

  WB analysis of HepG2 using 18254-1-AP

  WB result of APOE antibody (18254-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-APOE transfected HepG2 cells.

• 

  WB analysis using 18254-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18254-1-AP (APOE antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human skin cancer using 18254-1-AP

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 18254-1-AP (APOE antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human skin cancer using 18254-1-AP

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 18254-1-AP (APOE antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 18254-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using APOE antibody (18254-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• Featured Product
• KD/KO Validated

APOE Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 18254-1-AP

Publications(16)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Apo E, Apo-E, apoe4, apolipoprotein E, ApolipoproteinE

---

Tested Applications

• Positive WB detected in: HepG2 cells, HuH-7 cells, human plasma
• Positive IHC detected in: human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 10 publications below
• IHC: See 2 publications below
• IF: See 7 publications below

Product Information

18254-1-AP targets APOE in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13070

  Product name: Recombinant human APOE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 18-284 aa of BC003557

  Sequence: AKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFE

• Full Name: Apolipoprotein E
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 34-38 kDa
• GenBank Accession Number: BC003557
• Gene Symbol: APOE
• Gene ID (NCBI): 348
• RRID: AB_2878525
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P02649
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The apolipoprotein E (APOE) is a 299-amino acid polypeptide that mediates the binding, internalization, and catabolism of lipoprotein particles, and also serves as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues. The very strong association of the APOE ɛ4 allele with AD risk and its role in the accumulation of amyloid β in brains of people and animal models solidify the biological relevance of APOE isoforms but do not provide mechanistic insight. APOE can be detected 43kDa and 69kDa dimers (PMID: 9831633).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Br J Cancer; A new panel of pancreatic cancer biomarkers discovered using a mass spectrometry-based pipeline.; Authors - Xiaohui Liu
human	IHC	Transl Oncol; Multi-omics analysis-based macrophage differentiation-associated papillary thyroid cancer patient classifier; Authors - Hanlin Sun
mouse	WB	Biochim Biophys Acta Mol Cell Biol Lipids; Inducible global knockout of surfeit locus protein 4 in adult mice results in hypolipidemia, intestinal lipid accumulation, liver injury, and increased mortality; Authors - Wei Chen
human	WB	J Virol; SARS-CoV-2 disrupts proximal elements in the JAK-STAT pathway.; Authors - Da-Yuan Chen
human	WB	bioRxiv; SARS-CoV-2 desensitizes host cells to interferon through inhibition of the JAK-STAT pathway.; Authors - Da-Yuan Chen
human	IF	Stem Cell Res Ther; Single-cell sequencing of facial adipose tissue unveils FKBP5 as a therapeutic target for facial infiltrating lipomatosis; Authors - Hongrui Chen