Recombinant human ARGLU1 protein
Source
e coli.-derived, PET28a
Tag
6*His
Format
Liquid
Cat no : Ag28084
Synonyms
ARGLU1, Arginine and glutamate-rich protein 1
Validation Data Gallery View All
Product Information
| Peptide Sequence |
TAVSRRERDRERASSPPDRIDIFGRTVSKRSSLDEKQKREEEEKKAEFERQRKIRQQEIEEKLIEEETARRVEELVAKRVEEELEKRKDEIEREVLRRVEEAKRIMEKQLLEELERQRQAELAAQKARE
(63-191 aa encoded by BC071587) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
