ARL2BP Polyclonal antibody

• 

  WB analysis of A549 using 10090-2-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 10090-2-AP (ARL2BP Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human pancreas cancer using 10090-2-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 10090-2-AP (ARL2BP antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 10090-2-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 10090-2-AP (ARL2BP antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

ARL2BP Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10090-2-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

RP66, BART1, BART, ARF-like 2-binding protein, ADP-ribosylation factor-like protein 2-binding protein

---

Tested Applications

• Positive WB detected in: A549 cells
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 6 publications below
• IF: See 5 publications below
• IP: See 1 publications below

Product Information

10090-2-AP targets ARL2BP in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0138

  Product name: Recombinant human ARL2BP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-163 aa of BC003087

  Sequence: MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH

• Full Name: ADP-ribosylation factor-like 2 binding protein
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC003087
• Gene Symbol: ARL2BP
• Gene ID (NCBI): 23568
• RRID: AB_2058518
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2Y0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ARF-like proteins (ARLs) belong to a group of incompletely characterized members in the ARF family of RAS-related GTPases. A 19-kDa protein (BART, Binder of Arl Two) was identified to bind specifically to ARL2.GDP with high affinity but not with ARL2.GDP. In human, the 489-base pair BART open reading frame encodes a novel 163-amino acid protein with a predicted molecular mass of 18,822 Da. Data from Northern and Western analyses indicated BART is expressed in many tissues.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Am J Hum Genet; Mutations in ARL2BP, Encoding ADP-Ribosylation-Factor-Like 2 Binding Protein, Cause Autosomal-Recessive Retinitis Pigmentosa.; Authors - Davidson Alice E AE ; KD Validated
human	WB	Cancer Res; Intracellular CD24 inhibits cell invasion by posttranscriptional regulation of BART through interaction with G3BP.; Authors - Keisuke Taniuchi
human	WB,IF	Neoplasia; BART inhibits pancreatic cancer cell invasion by Rac1 inactivation through direct binding to active Rac1.; Authors - Taniuchi Keisuke K ; KD Validated
human	WB,IF	PLoS One; BART inhibits pancreatic cancer cell invasion by PKCα inactivation through binding to ANX7.; Authors - Taniuchi Keisuke K ; KD Validated
human	WB,IF	Invest Ophthalmol Vis Sci; Truncation mutation in HRG4 (UNC119) leads to mitochondrial ANT-1-mediated photoreceptor synaptic and retinal degeneration by apoptosis.; Authors - Mori Naoki N
human	WB,IF,IP	Int J Oncol; BART inhibits pancreatic cancer cell invasion by inhibiting ARL2-mediated RhoA inactivation.; Authors - Taniuchi Keisuke K