ASRGL1 Polyclonal antibody

• 

  WB analysis of HeLa using 11400-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11400-1-AP (ASRGL1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 11400-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 11400-1-AP (ASRGL1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 11400-1-AP

  IP result of anti-ASRGL1 (IP:11400-1-AP, 4ug; Detection:11400-1-AP 1:500) with HeLa cells lysate 3200ug.

• 

  IHC staining of human gliomas using 11400-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 11400-1-AP (ASRGL1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 11400-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using ASRGL1 antibody (11400-1-AP) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

ASRGL1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11400-1-AP

Publications(16)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

ALP, ALP1, Asparaginase-like protein 1, ASRGL 1, Beta-aspartyl-peptidase

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 9 publications below
• IHC: See 5 publications below
• IF: See 2 publications below

Product Information

11400-1-AP targets ASRGL1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, cat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1955

  Product name: Recombinant human ASRGL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-308 aa of BC021295

  Sequence: MNPIVVVHGGGAGPISKDRKERVHQGMVRAATVGYGILREGGSAVDAVEGAVVALEDDPEFNAGCGSVLNTNGEVEMDASIMDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLVTERNKKRLEKEKHEKGAQKTDCQKNLGTVGAVALDCKGNVAYATSTGGIVNKMVGRVGDSPCLGAGGYADNDIGAVSTTGHGESILKVNLARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTSTSMPWAAAKDGKLHFGIDPDDTTITDLP

• Full Name: asparaginase like 1
• Calculated Molecular Weight: 308 aa, 32 kDa
• Observed Molecular Weight: 32-40 kDa, 20-25 kDa, 15-19 kDa
• GenBank Accession Number: BC021295
• Gene Symbol: ASRGL1
• Gene ID (NCBI): 80150
• RRID: AB_2060440
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7L266
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Asparaginase-like protein 1 (ASRGL1) is also named as ALP, CRASH and belongs to the Ntn-hydrolase family. ASRGL1 has both L-asparaginase and beta-aspartyl peptidase activity. It may be involved in the production of L-aspartate, which can act as an excitatory neurotransmitter in some brain regions. ASRGL1 has 2 isoforms produced by alternative splicing with the MW of 32 kDa and 19 kDa. Two lower molecular weight bands (23 and 15 kDa) can be detected corresponding to the processed α and β subunits (PMID: 27106100).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human		Cell Metab; As Extracellular Glutamine Levels Decline, Asparagine Becomes an Essential Amino Acid.; Authors - Natalya N Pavlova
mouse	WB	Nat Chem Biol; PMID: 28671681; Authors - Nunzio Iraci
mouse	IF	Hum Mol Genet; A missense mutation in the ASRGL1 gene is involved in causing autosomal recessive retinal degeneration.; Authors - Pooja Biswas
cat	IHC	Front Cell Dev Biol; Oocyte Meiotic Competence in the Domestic Cat Model: Novel Roles for Nuclear Proteins BRD2 and NPM1.; Authors - Daniela R Chavez
human	WB	Front Oncol; ASRGL1 Correlates With Immune Cell Infiltration in Hepatocellular Carcinoma and Can Serve as a Prognostic Biomarker.; Authors - Cailin Xue
mouse	WB	Inflammation; Ghrelin Fights Against Titanium Particle-Induced Inflammatory Osteolysis Through Activation of β-Catenin Signaling Pathway.; Authors - Ruize Qu