ASZ1 Polyclonal antibody

• 

  WB analysis of mouse testis using 21550-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 21550-1-AP (ASZ1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human testis using 21550-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 21550-1-AP (ASZ1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse testis using 21550-1-AP

  IP result of anti-ASZ1 (IP:21550-1-AP, 4ug; Detection:21550-1-AP 1:600) with mouse testis tissue lysate 1560 ug.

ASZ1 Polyclonal Antibody for WB, IP, ELISA

Cat No. 21550-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, IP, ELISA

Synonyms

ALP1, ANKL1, Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1, Ankyrin-like protein 1, ASZ 1

---

Tested Applications

• Positive WB detected in: mouse testis tissue, human testis tissue
• Positive IP detected in: mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IF: See 5 publications below
• IP: See 2 publications below

Product Information

21550-1-AP targets ASZ1 in WB, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16217

  Product name: Recombinant human ASZ1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 20-372 aa of BC034963

  Sequence: SEDDGWEIGYLDRTSQKLKRLLPIEEKKEKFKKAMTIGDVSLVQELLDSGISVDSNFQYGWTPLMYAASVANAELVRVLLDRGANASFEKDKQSILITACSAHGSEEQILKCVELLLSRNADPNVACRRLMTPIMYAARDGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTICKILTTDSDREKDHIFSSYTAFGDLEVFLHGLGLEHMTDLLKERDITLRHLLTMREDEFTKNGITSKDQQKILAALKELQVEEIQFGELSEETKLEISGDEFLNFLLKLNKQCGHLIT

• Full Name: ankyrin repeat, SAM and basic leucine zipper domain containing 1
• Calculated Molecular Weight: 475 aa, 53 kDa
• Observed Molecular Weight: 48-50 kDa
• GenBank Accession Number: BC034963
• Gene Symbol: ASZ1
• Gene ID (NCBI): 136991
• RRID: AB_10858622
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WWH4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF, WB	Nat Commun; PNLDC1 is essential for piRNA 3' end trimming and transposon silencing during spermatogenesis in mice.; Authors - Deqiang Ding
mouse	IF	Dev Cell; TDRD1 phase separation drives intermitochondrial cement assembly to promote piRNA biogenesis and fertility; Authors - Jie Gao
mouse	WB,IF,IP	Development; MFN2 interacts with nuage-associated proteins and is essential for male germ cell development by controlling mRNA fate during spermatogenesis; Authors -
mouse	WB,IF,IP	Development; MFN2 interacts with nuage-associated proteins and is essential for male germ cell development by controlling mRNA fate during spermatogenesis.; Authors - Xiaoli Wang
mouse	WB	Andrology; Intermitochondrial cement (IMC) harbors piRNA biogenesis machinery and exonuclease domain-containing proteins EXD1 and EXD2 in mouse spermatocytes; Authors - Opeyemi Olotu
mouse	IF	Nucleic Acids Res; Mitochondrial membrane-based initial separation of MIWI and MILI functions during pachytene piRNA biogenesis.; Authors - Deqiang Ding