ATG12 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ATG12 Polyclonal antibody (11264-1-AP)

• Featured Product
• KD/KO Validated

ATG12 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11264-1-AP Copied!

Publications (20)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

APG12, APG12 like, APG12L, APG12-like, Autophagy-related protein 12

• 

  WB analysis using 11264-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 11264-1-AP (ATG12 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 11264-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11264-1-AP (ATG12 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HCT 116 using 11264-1-AP

  HCT 116 cells were subjected to SDS PAGE followed by western blot with 11264-1-AP (ATG12 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 11264-1-AP

  WB result of ATG12 antibody (11264-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ATG12 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of COLO 320 using 11264-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 11264-1-AP (ATG12 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 11264-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 11264-1-AP (ATG12 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 11264-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11264-1-AP (ATG12 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 11264-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11264-1-AP (ATG12 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 11264-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11264-1-AP (ATG12 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 11264-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11264-1-AP (ATG12 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of PC-3 using 11264-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using ATG12 antibody (11264-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ATG12 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: PC-3 cells, COLO 320 cells, NIH/3T3 cells, HeLa cells, HCT 116 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11264-1-AP targets ATG12 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1791

  Product name: Recombinant human ATG12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-187 aa of BC012266

  Sequence: MTSREHQVSLCNCVPLLRRLLCDAPWRKARPLHALSRYFRSRVSPSKMAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG

• Full Name: ATG12 autophagy related 12 homolog (S. cerevisiae)
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 48-55 kDa
• GenBank Accession Number: BC012266
• Gene Symbol: ATG12
• Gene ID (NCBI): 9140
• RRID: AB_10807096
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O94817
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATG12, also named as APG12 and APG12L, belongs to the ATG12 family. It is required for autophagy. Free ATG12 is 15kd or 8kd. Conjugated to ATG5, ATG12-ATG5 show 48-55kd.

Publications

What published studies show

The ATG12 Polyclonal Antibody (Cat# 11264-1-AP) has 20 citations published in journals including Autophagy, Advanced Science, Cancer Science, Journal of Ethnopharmacology, European Journal of Pharmacology, Frontiers in Cell and Developmental Biology, Chemical Biology & Interactions, Journal of Cellular and Molecular Medicine, Neurochemistry Research, Biochemical Journal, Pharmacology, PLoS ONE, and Theranostics. Research fields span autophagy regulation, cancer biology, liver disease, neuroprotection, renal fibrosis, inflammation, and cardiac dysfunction.

Automatically generated from the 20 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Autophagy; WNT2B impairs endosomal trafficking via WASHC5 to inhibit autophagy: a novel non-secretory WNT pathway.; Authors - Danqiong Liu
human	WB	Adv Sci (Weinh); Mitochondrial tRNAGlu 14693A>G Mutation, an "Enhancer" to the Phenotypic Expression of Leber's Hereditary Optic Neuropathy; Authors - Lihao Jin
human	WB	Chin Med J (Engl); MiR-3653 blocks autophagy to inhibit epithelial-mesenchymal transition in breast cancer cells by targeting the autophagy-regulatory genes ATG12 and AMBRA1; Authors - Huachen Song ; KD Validated
mouse,human	WB	J Ethnopharmacol; Licochalcone A promotes autophagy to ameliorate NAFLD by inhibiting the mTOR and regulating ULK1/Beclin1/VPS34 pathway; Authors - Jingjing Li
human	WB	Eur J Pharmacol; Latcripin-7A from Lentinula edodes C91-3 induces apoptosis, autophagy, and cell cycle arrest at G1 phase in human gastric cancer cells via inhibiting PI3K/Akt/mTOR signaling.; Authors - Syed Riaz Ud Din
rat	WB,IF	Front Cell Dev Biol; Enhancing autophagy and energy metabolism in the meniscus can delay the occurrence of PTOA in ACLT rat; Authors - Huangrong Zhu