ATG12 Polyclonal antibody

• 

  WB analysis using 11264-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 11264-1-AP (ATG12 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 11264-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11264-1-AP (ATG12 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HCT 116 using 11264-1-AP

  HCT 116 cells were subjected to SDS PAGE followed by western blot with 11264-1-AP (ATG12 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COLO 320 using 11264-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 11264-1-AP (ATG12 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 11264-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 11264-1-AP (ATG12 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 11264-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11264-1-AP (ATG12 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 11264-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11264-1-AP (ATG12 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 11264-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11264-1-AP (ATG12 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 11264-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11264-1-AP (ATG12 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of PC-3 using 11264-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using ATG12 antibody (11264-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• Featured Product
• KD/KO Validated

ATG12 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11264-1-AP

Publications(12)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

APG12, APG12 like, APG12L, APG12-like, Autophagy-related protein 12

---

Tested Applications

• Positive WB detected in: PC-3 cells, COLO 320 cells, NIH/3T3 cells, HeLa cells, HCT 116 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 11 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

11264-1-AP targets ATG12 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1791

  Product name: Recombinant human ATG12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-187 aa of BC012266

  Sequence: MTSREHQVSLCNCVPLLRRLLCDAPWRKARPLHALSRYFRSRVSPSKMAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG

• Full Name: ATG12 autophagy related 12 homolog (S. cerevisiae)
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 48-55 kDa
• GenBank Accession Number: BC012266
• Gene Symbol: ATG12
• Gene ID (NCBI): 9140
• RRID: AB_10807096
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O94817
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATG12, also named as APG12 and APG12L, belongs to the ATG12 family. It is required for autophagy. Free ATG12 is 15kd or 8kd. Conjugated to ATG5, ATG12-ATG5 show 48-55kd.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Adv Sci (Weinh); Mitochondrial tRNAGlu 14693A>G Mutation, an "Enhancer" to the Phenotypic Expression of Leber's Hereditary Optic Neuropathy; Authors - Lihao Jin
rat	WB,IF	Front Cell Dev Biol; Enhancing autophagy and energy metabolism in the meniscus can delay the occurrence of PTOA in ACLT rat; Authors - Huangrong Zhu
human	WB	Biochem J; Protease-Activated Receptor-2 promotes kidney tubular epithelial inflammation by inhibiting autophagy via the PI3K/Akt/mTOR signalling pathway.; Authors - Chunyang Du
rat	WB	Biology (Basel); Autophagy Alters Bladder Angiogenesis and Improves Bladder Hyperactivity in the Pathogenesis of Ketamine-Induced Cystitis in a Rat Model.; Authors - Jian-He Lu
mouse,human	WB	Int J Biochem Cell Biol; Sphingosine kinase 1 protects renal tubular epithelial cells from renal fibrosis via induction of autophagy.; Authors - Chunyang Du
human	WB	Eur J Pharmacol; Latcripin-7A from Lentinula edodes C91-3 induces apoptosis, autophagy, and cell cycle arrest at G1 phase in human gastric cancer cells via inhibiting PI3K/Akt/mTOR signaling.; Authors - Syed Riaz Ud Din