CoraLite® Plus 488-conjugated ATG12 Polyclonal antibody

• 

  IF Staining of PC-3 using CL488-11264

  Immunofluorescent analysis of (4% PFA) fixed PC-3 cells using CoraLite® Plus 488 ATG12 antibody (CL488-11264) at dilution of 1:200.

• Featured Product
• KD/KO Validated

ATG12 Polyclonal Antibody for IF/ICC

Cat No. CL488-11264

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

APG12, APG12 like, APG12L, ATG12, Autophagy related protein 12, FBR93, HAPG12, Ubiquitin like protein ATG12

---

Tested Applications

• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-11264 targets ATG12 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1791

  Product name: Recombinant human ATG12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-187 aa of BC012266

  Sequence: MTSREHQVSLCNCVPLLRRLLCDAPWRKARPLHALSRYFRSRVSPSKMAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG

• Full Name: ATG12 autophagy related 12 homolog (S. cerevisiae)
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 48-55 kDa
• GenBank Accession Number: BC012266
• Gene Symbol: ATG12
• Gene ID (NCBI): 9140
• RRID: AB_3083895
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen Affinity Purified
• UNIPROT ID: O94817
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

ATG12, also named as APG12 and APG12L, belongs to the ATG12 family. It is required for autophagy. Free ATG12 is 15kd or 8kd. Conjugated to ATG5, ATG12-ATG5 show 48-55kd.