Tested Applications
| Positive WB detected in | Neuro-2a cells, HepG2 cells, mouse small intestine tissue, mouse brain tissue, rat brain tissue, C6 cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.4 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 25 publications below |
| IHC | See 4 publications below |
| IF | See 22 publications below |
| ChIP | See 1 publications below |
Product Information
21215-1-AP targets ATOH1 in WB, IHC, IF/ICC, FC (Intra), chIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15615 Product name: Recombinant human ATOH1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-354 aa of BC069594 Sequence: MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPSGGEQPPPPPASCKSDHHHLRTAASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS Predict reactive species |
| Full Name | atonal homolog 1 (Drosophila) |
| Calculated Molecular Weight | 354 aa, 38 kDa |
| Observed Molecular Weight | 38-40 kDa |
| GenBank Accession Number | BC069594 |
| Gene Symbol | ATOH1 |
| Gene ID (NCBI) | 474 |
| RRID | AB_10733126 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92858 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ATOH1, also named as Protein atonal homolog 1 or BHLHA14, is a 364 amino acid protein, which contains 1 bHLH (basic helix-loop-helix) domain. ATOH1,as a transcriptional regulator in the nucleus activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. ATOH1 plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ATOH1 antibody 21215-1-AP | Download protocol |
| IHC protocol for ATOH1 antibody 21215-1-AP | Download protocol |
| WB protocol for ATOH1 antibody 21215-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Res Decoding the spatiotemporal regulation of transcription factors during human spinal cord development | ||
Immunity IL-17RA-signaling in Lgr5+ intestinal stem cells induces expression of transcription factor ATOH1 to promote secretory cell lineage commitment. | ||
Nat Cell Biol Merkel cell polyomavirus activates LSD1-mediated blockade of non-canonical BAF to regulate transformation and tumorigenesis. | ||
J Clin Invest Sox2 haploinsufficiency primes regeneration and Wnt responsiveness in the mouse cochlea. | ||
Dev Cell Self-organized pattern formation in the developing mouse neural tube by a temporal relay of BMP signaling | ||
Proc Natl Acad Sci U S A Sufu- and Spop-mediated regulation of Gli2 is essential for the control of mammalian cochlear hair cell differentiation |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Nicole (Verified Customer) (08-08-2024) | Works really well both in Western Blot and Immunofluorescence
|
FH Yin (Verified Customer) (12-20-2021) | It did not work.
|
FH Stephen (Verified Customer) (11-04-2020) | ATOH1 antibody was tested on embryonic chicken tissue. Staining showed nuclear localisation in inner ear vestibular crista in sox2 positive prosensory region of 6 day old embryo
![]() |
FH Roland (Verified Customer) (09-17-2020) | We tested several ATOH1 antibodies and this is the only one which turned out to be specific as confirmed bei knockdown experiments.
|
FH Biren (Verified Customer) (08-31-2020) | I used human GBM stem cells as a negative control to validate the specificity of this antibody. The cells used were confirmed by RNAseq to not express ATOH1, yet all cells were positively stained at the previously used concentration of 1/500, indicating that this antibody is not specific.
![]() |
FH Erithelgi (Verified Customer) (09-25-2019) | The antibody detects a band of the expected size, in cells that induce GFP-ATOH1 under a DOX promoter. No bands detected in non-induced cells.
|
FH Nicole (Verified Customer) (07-23-2019) | Used to stain cultured stem cells for differentiation markers.
|





















