ATOH1 Polyclonal antibody

ATOH1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA
Cat No. 21215-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), chIP, ELISA

ATH1, bHLHa14, Class A basic helix-loop-helix protein 14, HATH1, Helix-loop-helix protein hATH-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNeuro-2a cells, HepG2 cells, mouse small intestine tissue, mouse brain tissue, rat brain tissue, C6 cells
Positive IHC detected inhuman colon cancer tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.4 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21215-1-AP targets ATOH1 in WB, IHC, IF/ICC, FC (Intra), chIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, monkey
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15615

Product name: Recombinant human ATOH1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-354 aa of BC069594

Sequence: MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPSGGEQPPPPPASCKSDHHHLRTAASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS

Predict reactive species
Full Name atonal homolog 1 (Drosophila)
Calculated Molecular Weight 354 aa, 38 kDa
Observed Molecular Weight 38-40 kDa
GenBank Accession NumberBC069594
Gene Symbol ATOH1
Gene ID (NCBI) 474
RRIDAB_10733126
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ92858
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATOH1, also named as Protein atonal homolog 1 or BHLHA14, is a 364 amino acid protein, which contains 1 bHLH (basic helix-loop-helix) domain. ATOH1,as a transcriptional regulator in the nucleus activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. ATOH1 plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription.

Protocols

Product Specific Protocols
FC protocol for ATOH1 antibody 21215-1-APDownload protocol
IF protocol for ATOH1 antibody 21215-1-APDownload protocol
IHC protocol for ATOH1 antibody 21215-1-APDownload protocol
WB protocol for ATOH1 antibody 21215-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Cell Res

Decoding the spatiotemporal regulation of transcription factors during human spinal cord development

Authors - Yingchao Shi
humanIF

Immunity

IL-17RA-signaling in Lgr5+ intestinal stem cells induces expression of transcription factor ATOH1 to promote secretory cell lineage commitment.

Authors - Xun Lin
humanWB

Nat Cell Biol

Merkel cell polyomavirus activates LSD1-mediated blockade of non-canonical BAF to regulate transformation and tumorigenesis.

Authors - Donglim Esther Park
mouseIHC

J Clin Invest

Sox2 haploinsufficiency primes regeneration and Wnt responsiveness in the mouse cochlea.

Authors - Patrick J Atkinson
IF

Dev Cell

Self-organized pattern formation in the developing mouse neural tube by a temporal relay of BMP signaling

Authors - Stefanie Lehr
mouseIF

Proc Natl Acad Sci U S A

Sufu- and Spop-mediated regulation of Gli2 is essential for the control of mammalian cochlear hair cell differentiation

Authors - Tianli Qin

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Bénédicte (Verified Customer) (02-13-2026)

IF/IHC staining of mouse colon using 21215-1-AP (ATOH1 antibody). Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 21215-1-AP (ATOH1 antibody) at dilution of 1:500 (scale bar : 50 m). Heat mediated antigen retrieval with Citrate buffer (pH 6.0).Remark : background at the brush of the crypts (upper part) and the specific stainings are the few positive nuclei at the bottom of the crypts (stem cells).

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1/500
  • Cell Tissue Type: mouse colon
ATOH1 Antibody Immunohistochemistry validation (1/500 dilution) in mouse colon (Cat no:21215-1-AP)
FH

Nicole (Verified Customer) (08-08-2024)

Works really well both in Western Blot and Immunofluorescence

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:500
FH

Yin (Verified Customer) (12-20-2021)

It did not work.

  • Applications: Immunofluorescence
  • Cell Tissue Type: Cerebella granule cell
FH

Stephen (Verified Customer) (11-04-2020)

ATOH1 antibody was tested on embryonic chicken tissue. Staining showed nuclear localisation in inner ear vestibular crista in sox2 positive prosensory region of 6 day old embryo

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:300
  • Cell Tissue Type: Embryonic chicken inner ear tissue
ATOH1 Antibody Immunofluorescence validation (1:300 dilution) in Embryonic chicken inner ear tissue (Cat no:21215-1-AP)
FH

Roland (Verified Customer) (09-17-2020)

We tested several ATOH1 antibodies and this is the only one which turned out to be specific as confirmed bei knockdown experiments.

  • Applications: Western Blot
  • Cell Tissue Type: human cancer cells
FH

Biren (Verified Customer) (08-31-2020)

I used human GBM stem cells as a negative control to validate the specificity of this antibody. The cells used were confirmed by RNAseq to not express ATOH1, yet all cells were positively stained at the previously used concentration of 1/500, indicating that this antibody is not specific.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1/500
  • Cell Tissue Type: human glioblastoma stem cells
ATOH1 Antibody Immunofluorescence validation (1/500 dilution) in human glioblastoma stem cells (Cat no:21215-1-AP)
FH

Erithelgi (Verified Customer) (09-25-2019)

The antibody detects a band of the expected size, in cells that induce GFP-ATOH1 under a DOX promoter. No bands detected in non-induced cells.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: medulloblastoma
FH

Nicole (Verified Customer) (07-23-2019)

Used to stain cultured stem cells for differentiation markers.

  • Applications: Immunohistochemistry, Immunofluorescence,
  • Cell Tissue Type: Stem Cell culture
Loading...
||
New chat

Able

正在加载,请稍候...