CoraLite®594-conjugated ATOH1 Polyclonal antibody

• 

  FC experiment of HepG2 using CL594-21215

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug CoraLite®594 Anti-Human ATOH1 (CL594-21215) (red), or 0.4 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

ATOH1 Polyclonal Antibody for FC (Intra)

Cat No. CL594-21215

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

Synonyms

MATH 1, Helix-loop-helix protein hATH-1, HATH1, Class A basic helix-loop-helix protein 14, bHLHa14

---

Tested Applications

• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-21215 targets ATOH1 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15615

  Product name: Recombinant human ATOH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-354 aa of BC069594

  Sequence: MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPSGGEQPPPPPASCKSDHHHLRTAASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS

• Full Name: atonal homolog 1 (Drosophila)
• Calculated Molecular Weight: 354 aa, 38 kDa
• Observed Molecular Weight: 38-40 kDa
• GenBank Accession Number: BC069594
• Gene Symbol: ATOH1
• Gene ID (NCBI): 474
• RRID: AB_2919862
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92858
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

ATOH1, also named as Protein atonal homolog 1 or BHLHA14, is a 364 amino acid protein, which contains 1 bHLH (basic helix-loop-helix) domain. ATOH1,as a transcriptional regulator in the nucleus activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. ATOH1 plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription.